KEGG   Caenorhabditis elegans (nematode): CELE_K09C8.1
Entry
CELE_K09C8.1      CDS       T00019                                 

Gene name
pbo-4
Definition
(RefSeq) Na(+)/H(+) exchanger protein 7
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 181285
NCBI-ProteinID: NP_509830
WormBase: WBGene00003943
Ensembl: WBGene00003943
UniProt: G5EBK1
Position
X:join(10954134..10954315,10954365..10954549,10954935..10955022,10955068..10955224,10955268..10955552,10955602..10955713,10955766..10955943,10955989..10956202,10956248..10956373,10956419..10956574,10956622..10956740,10956853..10957081,10957136..10957227,10957282..10957406,10957956..10958059)
AA seq 783 aa
MWIKLLFFFTTLLVSTSGLGDDGITALLDPNSTEFSTVLPSNNSEKFSYMLASVKNMNMT
ASEFEEFIKVLKHRQSKDHSGEHVGNEHDESHGISVVSWHWDYVKNELVLTLFFIVIGLF
KLVYHHTFVTRKILPESCCLIFIGIAIGFFFVGDATHASIKFLEFKSKVFFFYLLPPIIL
ESAYSLKDRAFIENIGTILLYAVVGTILNIVLLAAALLILIWVGIMGKYNLSVMDILTFA
SLVAAVDPVAVLAVFQEVGVNKMLYFMVFGESLFNDAVTIVCYNLAIEFQTLPDFTWYHG
FLGLLSFLCVSIGGLIIGLICGAISSFVTKFTTDVRVVEPVVLFGMAYLAYLGSEMFHFS
GIIALIACGLFQTHYACCNISYKSFTSVMYITKVCSTLCESLIFIILGVMLVNEREWFWT
DWHPVFSAVSVVLCVVVRFGVTFFLTYFVNQFTGGVRHISFQEQFIMSYGGLRGAVSFSL
VFMISANPDVKNTMLGATYAVILFTNIIQGSTIKLFVKWLNIRLAKKEDHFRLFIEFNNG
MVQHLSQGIEDLCGDKSLSLINRMSELSKKYVRPLLEKNYTANKAKKEGKLVELNRAVAM
REALNNSPSQSSFQRQHTIDEMAESGALPHDLLDEEHQGHHHHGQVHPDNEDADQRANEL
IKDVSSIRQLMHNPFEDCYLDRNLTHEEEKEQARLKMKKTRAFKFSSVRKTIGFFGKKKS
VRRHATQQGILHSAIATIGVQSVDRPSTSTRVSVEDEEQGLTMKEMEEEHPLMTITESEE
TSF
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgtggattaaactattattctttttcactactctgctagtatccacaagtggtctgggg
gacgatggaatcacagctcttcttgaccccaactctacagaattttcaacggtgttaccg
tctaacaattctgagaaatttagctacatgttagcatctgtgaaaaacatgaacatgaca
gcctccgaatttgaagagttcataaaagtactcaaacataggcaatctaaagatcattct
ggtgagcacgttggtaatgagcacgatgaatcacatggaatcagtgttgtgtcttggcat
tgggactacgtgaaaaacgagttggtgctcaccctatttttcatcgttatcggtcttttt
aaacttgtatatcaccacacctttgtcactagaaaaattcttcccgaatcatgttgcttg
atctttattggcattgctattggattcttttttgttggagatgcgactcacgcgtctatc
aaattcctggaattcaaatcgaaagtgttcttcttctacctcttgcctccaattattctg
gaatctgcttactctttaaaggatagagcatttattgagaatattggaactatccttctc
tatgctgttgtgggaacaattttgaacattgttctgctagcagctgcacttttgattttg
atttgggttggaataatgggaaaatacaatctcagtgtcatggatatcctgacattcgca
tcacttgtagcagcagtagatcctgtggcagttctcgcagtattccaagaagttggagtt
aacaagatgttgtatttcatggtgtttggagagtcattatttaatgatgccgttactatt
gtttgttataatcttgctattgaattccaaacacttccggattttacatggtatcatgga
ttcctaggattattgtcatttttgtgcgtgtcaattggtggtttgattattggattaatt
tgtggtgcaatttcctcatttgtaacaaagtttacaacagatgttcgagttgtcgaacca
gttgtcttgtttggaatggcttaccttgcttatctgggaagtgaaatgttccacttttct
ggaattattgcactgattgcctgcggattgtttcaaactcattatgcctgttgtaacatc
tcgtataaatctttcacaagtgtgatgtacataacaaaagtttgcagtacactttgcgag
tcgcttatttttattattctcggagttatgcttgtaaatgaaagggaatggttttggaca
gactggcatcctgtgttctctgcagtttcggttgtgctctgtgttgttgtgagatttgga
gtcacatttttcttaacctattttgtcaatcaatttacgggtggtgtgcgacatatttct
tttcaagagcagttcattatgtcatacggaggccttcgtggtgccgtgtctttctccttg
gtttttatgatatctgcaaacccagatgtcaagaacacaatgcttggtgcaacgtatgca
gttatccttttcaccaacatcatccagggttctacgatcaaactatttgtcaaatggcta
aatattcgtttggctaaaaaagaagatcacttccgtcttttcattgagtttaacaatggc
atggtgcagcatttatcgcaaggaatcgaagacttgtgtggtgacaagagtttaagcctg
attaacagaatgagtgaactttctaaaaaatatgttcggcctctcctcgagaaaaattat
actgctaataaagctaagaaagaaggaaaattggtagaactcaacagagcagttgcaatg
cgagaggcgctgaacaacagtccatcacaaagttcattccaaagacagcacacaattgat
gagatggcggaaagcggagctttaccacacgacttattggatgaagagcaccagggacac
catcatcacggacaagtgcacccagacaatgaagatgctgaccagcgtgcaaatgagctt
atcaaagacgtgtcttctattcgtcagctcatgcacaatccattcgaagattgctacctg
gaccgcaatttgacacacgaggaggaaaaagagcaagcacgattgaaaatgaaaaagaca
agagcattcaaattttcttcagtaaggaaaacaataggattctttggaaaaaagaagtca
gttcgcagacatgccactcaacaaggcatccttcactctgcaattgcaaccatcggagta
caatcagttgatcgaccatcaacgtcaactcgagtaagtgtggaagatgaggagcagggt
ttgacaatgaaagaaatggaagaggaacacccacttatgacaatcacagaaagcgaagag
acaagcttctga

DBGET integrated database retrieval system