KEGG   Caenorhabditis elegans (nematode): CELE_K09C8.5
Entry
CELE_K09C8.5      CDS       T00019                                 

Gene name
pxn-2
Definition
(RefSeq) Peroxidasin homolog pxn-2
  KO
K19511  peroxidase [EC:1.11.1.7]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CELE_K09C8.5 (pxn-2)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     CELE_K09C8.5 (pxn-2)
Motif
Pfam: An_peroxidase I-set Ig_3 ig Ig_2 LRR_8 LRR_4 V-set LRRNT Ig_C17orf99 C2-set_2 LRR_9
Other DBs
NCBI-GeneID: 181288
NCBI-ProteinID: NP_509834
WormBase: WBGene00004257
Ensembl: WBGene00004257
UniProt: G5EG78
Position
X:complement(join(10972272..10972322,10972536..10972814,10972894..10973123,10973226..10973403,10974671..10974817,10974865..10975118,10975327..10975432,10975480..10975597,10975660..10976023,10976203..10976607,10976655..10976821,10976875..10977083,10977128..10977281,10977381..10977535,10977585..10977969,10978014..10978138,10978191..10978305,10978349..10978494,10978771..10978914,10978965..10979119,10979166..10979265))
AA seq 1328 aa
MLLEFLLLIGISLSTACPSECRCAGLDVHCEGKNLTAIPGHIPIATTNLYFSNNLLNSLS
KSNFQALPNLQYLDLSNNSIRDIEETLLDSFPGLKYLDLSWNKIRYVPKLSTAPNALVSL
NLVHNEISRLDNDLVSHSPYMQTFLIQRNRIQSLPHDFFNSRMVPTLKTVKMAGNPWSCD
CRMVNVKQFADSLFAHSNQNIFIVGKCFFPKGLRNYVFRNLSIENLECEKPEYSKTDDGM
FKMSCPNNEMEGYHYDSIFLENNKEARHTAHFARDKDGSLLSNGQFTRNYQCAFYRQKQS
IHMQKKMQASSSTEPPITTTTMEPMTTSTMDSMDTTESVVTMTTMPEIDTKIVFEHKQLD
TTSRDGETLELKCEASGEPTPTITWLFEKQKLTESRKHKLTKNGSVLKIFPFLNTDIGQY
ECVASNGEESKSHIFSVSLKESEQPVIIDAPMDTNATIGQQVTLRCNAKGFPVPDVVWLF
EGIRIPRRNTRYTISDNNIELTIEKVTRHDSGVFTCQAVNSVGSAVATANLLVGAELTEK
VDKLLDDSTIEKIAKEAKQKVEKALSSTKDQQRMDKIESPNDLSKLFKFAINLKKVDLGK
AREIYEESIRLVQMHIDNGLAFESAMISPNVSYEAVLPVSYVQTLMEKSGCQTGQFAESC
EDHCFFSKYRSYDGQCNNHEHPWWGVSEMAFMRLLPPRYENGFNTPVGWEKGKRYNGYEV
PNARKVSRVLIGTDETTPHSHLSAMTMQWGQFIDHDLTLTAPALTRHSYKEGAFCNRTCE
NADPCFNIQLEADDPKLHTGLYQKHPCMEFERNGAACGSGETSPIFQRVTYRDQLNLLTS
YLDASGIYGNSEEQALELRDLYSDHGLLRFDIVSGANKPYMPFEKDSDMDCRRNFSRENP
IKCFLAGDVRANEQLGLMSMHTIFLREHNRIASRLLEVNENWDGETIFQETRKLIGAMLQ
HITYNAWLPKILGKATYNTIIGEYKGYNPDVNPTIANEFATAALRFAHTLINTHLFRFDK
DFKETKQGHLPLHNAFFAPERLVSEGGVDPLLRGLFAAPIKMPRPDQVLNKELTEKLFNR
FHEVALDLAALNIQRGRDHGLPSWTEYRKFCNLTVPKTWSDMKNIVQNDTVISKLQSLYG
VTENIDLWVGGVTEKRTADALMGPTLACIIADQFKRLRDGDRFWYENEEMFSKAQLRQIK
KVTLSKIICTNGDDIDRIQRDIFVYHGNSTQFYEPCESLPEINLNMWTTCCDAMCSSSST
LARNAIGGDEKAKRRKRRHHHSKKSCHDKGKRRKSGDRWNHSNDICVECMCHDGEVWCKT
NNFCKSQV
NT seq 3987 nt   +upstreamnt  +downstreamnt
atgctcttagaattcctcttgctgattggaatttcactctccacagcgtgtccttcggaa
tgcagatgtgctggtttagatgttcattgtgaaggaaaaaatcttaccgcaattcctgga
catataccaattgcaactactaatttgtatttttcaaataatttgcttaactctctaagc
aaatccaattttcaagcactaccaaatctgcaatatctcgatttatcaaacaactccatt
cgagatattgaagagacgttgctagacagttttcctggattaaaataccttgatctctcc
tggaataaaattcgatacgttcccaagctatcaacagcaccaaatgctcttgtgagctta
aacctggttcataatgaaatatcaagacttgacaatgatttggtttctcatagtccatac
atgcaaacttttcttattcaacgcaatcgcattcaatctctgcctcatgattttttcaat
tcaagaatggttcccactttgaaaacagtcaaaatggcaggaaatccttggagttgtgat
tgcagaatggttaatgtaaaacaatttgctgattctttgtttgctcattccaatcagaac
atattcattgttggcaagtgctttttcccaaaaggactaaggaactatgtcttcagaaat
ctttcgatagaaaacctggaatgtgaaaagcctgaatacagcaaaactgatgatggaatg
ttcaaaatgagctgtccaaataatgaaatggagggttatcattatgattcaatattctta
gagaataataaggaagccagacacacagctcattttgcgcgtgacaaggatggttctctt
ctctcgaatggacaatttactagaaactatcaatgtgcattctaccgtcaaaagcagtca
attcacatgcaaaagaaaatgcaagcttcgtcatctactgaaccaccaatcacaacaacc
acaatggagcccatgactacgtcaactatggattcaatggataccacagaaagcgtcgtg
acaatgactacaatgccagaaatagatacaaagatagtatttgaacacaaacagctagac
acaacatcccgtgacggtgaaaccttggagcttaaatgcgaagcatctggagaaccgact
ccgactataacttggttgtttgaaaaacaaaaactgacggagtcacgcaaacacaaactt
accaaaaacggatcagttctgaaaatcttcccatttctgaacactgacattggtcagtac
gagtgtgttgcctctaatggtgaagaatctaagtctcatattttttctgtgtctttgaaa
gaaagtgaacaaccagttattattgatgcaccgatggatactaatgcaactattggacaa
caagtaacacttcgttgtaatgctaaaggatttccagttcctgacgtcgtttggcttttt
gaaggaattcgaattccacgtagaaacactagatacacgatatctgataacaatattgaa
ttaactattgaaaaagttacccgccacgactccggtgtgtttacctgtcaagcagtaaat
agtgttggctcggcagttgccaccgcgaatttgctagttggtgctgaattgacagaaaaa
gttgataaactccttgatgactcaacaattgaaaaaattgcaaaagaagcaaaacagaag
gtggaaaaagctttgtcatcaacaaaagaccaacaaagaatggataagattgaaagccca
aatgatttaagtaagcttttcaaatttgcaataaaccttaaaaaggttgatcttggaaag
gcacgagagatctatgaagaaagcatccgattagttcaaatgcacatcgataatggactt
gcattcgaatctgcaatgatctccccaaatgtgtcctacgaagccgttctgccagtatcc
tatgttcagacgttgatggaaaaatctggttgtcaaactggccaatttgcagaaagttgc
gaagatcactgctttttctcaaaatacagatcatatgatggtcagtgcaacaaccatgaa
catccgtggtggggagtttccgagatggcattcatgcgtctgttacctccaagatatgag
aacggattcaatacaccagttggctgggaaaaaggaaaacgatacaatggatatgaagtg
ccgaatgctcggaaagtgtcaagagtgctaattggaacagatgaaactacgccgcatagt
catttgagtgcaatgactatgcaatgggggcaatttattgatcacgatctcacactcact
gctccagccctcacccgacacagttacaaggagggagcattctgcaatagaacttgcgaa
aacgcagatccgtgctttaacattcaactggaagctgatgacccaaaacttcatactgga
ttgtatcaaaaacatccttgcatggaattcgagcggaatggagctgcgtgtggaagtgga
gaaacatcgccaattttccaacgagtaacttaccgcgatcaattgaatcttctaacatct
tatcttgatgcatccggaatttatggaaacagtgaagaacaggctctggaactgagagac
ttgtacagtgatcatggacttttaagatttgatattgtttccggagcgaataaaccatac
atgccgtttgaaaaagattccgacatggattgccgtcgtaacttttcccgcgagaatccg
atcaagtgtttccttgccggagatgtcagggccaatgaacagctgggtctcatgagcatg
cacaccatattcctcagagaacacaacagaattgcatcgagattgttggaagttaacgaa
aactgggatggtgaaactattttccaagaaactagaaagttgattggtgctatgctgcaa
cacatcacctacaatgcttggctccccaaaattcttggaaaggcaacatataacacaata
attggagagtacaaaggatacaatccagatgtcaatccaacaattgcaaatgagtttgca
accgcagctttgagattcgctcatactttaatcaatactcatcttttccgtttcgataag
gacttcaaagagacaaaacagggacatttacctctgcacaacgctttctttgctccggaa
agactagtctctgaaggtggcgttgatccattgctacgtggcctgtttgctgcaccaatt
aaaatgccaagacccgatcaagttctcaacaaagaattgacagaaaaattgtttaataga
ttccatgaggtagcccttgacctagctgctctcaacattcaaagaggccgagaccacggt
ctaccatcatggaccgaatatcgcaagttctgcaatctaactgtcccaaaaacttggtcc
gatatgaaaaacattgttcaaaacgatacagtcatttcaaaactgcaatccctctacggt
gtcacagagaacattgatctttgggttggaggtgttactgaaaagagaactgctgacgcg
ttgatgggaccaacacttgcgtgtataattgctgatcaattcaaacgcctgagagatggg
gatagattttggtatgagaatgaagaaatgttctcaaaggctcaacttcgacaaatcaag
aaagttacattgtcaaagatcatatgcacaaacggtgacgacattgaccgaattcagaga
gatattttcgtatatcacggtaacagcacacaattctatgagccctgtgagtcattaccg
gaaatcaacttgaacatgtggacaacatgttgcgatgcaatgtgctcatcaagctcaacg
ttggctcgcaatgcaattggtggcgatgaaaaagctaaacggcggaagagacgacatcac
cactcaaagaaaagctgtcacgataaaggaaaaagacggaagagtggagacagatggaat
cattccaatgatatctgtgttgaatgcatgtgccatgacggcgaagtttggtgcaaaacc
aacaatttctgcaaatctcaagtctga

DBGET integrated database retrieval system