KEGG   Caenorhabditis elegans (nematode): CELE_K10B4.6Help
Entry
CELE_K10B4.6      CDS       T00019                                 

Gene name
cwn-1
Definition
(RefSeq) Protein Wnt-1
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04150  mTOR signaling pathway
cel04310  Wnt signaling pathway
Module
cel_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_K10B4.6 (cwn-1)
   04150 mTOR signaling pathway
    CELE_K10B4.6 (cwn-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_K10B4.6 (cwn-1)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate/Haparin
  Morphogens
   CELE_K10B4.6 (cwn-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 173399
NCBI-ProteinID: NP_493668
WormBase: WBGene00000857
Ensembl: WBGene00000857
UniProt: P34888
Position
II:complement(join(131165..131296,131701..131814,131861..131993,132052..132146,132200..132397,132444..132516,132562..132681,132728..132820,133417..133577))
Genome map
AA seq 372 aa AA seqDB search
MLKSTQVILIFILLISIVESLSWLALGLAANRFDRDKPGTSCKSLKGLTRRQMRFCKKNI
DLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIPDVFLYENTRESAFVHAISSA
AVAYKVTRDCARGISERCGCDYSKNDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRV
LMMKDDNGTSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCW
DSLPNFRHIGMAIKDKFDGAAEVKVVKEDGIEKPRIVMKNSQFKRHTNADLVYMTPSPDF
CESDPLRGILGTKGRQCTLAPNAIDDCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCE
PCQKRIEKYLCL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaatctacacaagtgatcctaatcttcattttactgatttcaattgtcgaaagc
ttgtcatggttagcactcgggcttgctgccaaccgatttgacagagataaaccgggaacg
tcatgtaaatcactgaaagggctcaccaggaggcagatgagattctgtaaaaagaacatt
gacttaatggaaagtgttcgttcgggatctctcgctgctcatgctgaatgccaatttcaa
tttcataaacgcagatggaattgcactttgatcgatccggtgactcatgaagtcatcccg
gacgtttttctctatgaaaacactagagaatcggcatttgtacatgcaatttcgtcagct
gctgttgcttataaggttacccgagattgtgctagaggaataagtgaacgatgcggttgt
gactactcgaaaaacgatcactcagggaaaagtcaattccaatatcagggctgctcggac
aatgttaaatttggaattggtgtctccaaagagtttgttgattccgctcaacggagagtt
ttgatgatgaaggacgataatggaacaagtcttctgggacctagccagctgtctgccgat
ggaatgcatatgattaatttgcataataatcaagctggaagacaggtcctcgaaaagtct
cttcgtcgagaatgcaagtgtcatggaatgagtggatcttgtgaaatgaggacttgttgg
gattcattaccaaacttcaggcatatcggaatggcaatcaaggataagttcgatggagct
gccgaggttaaagtcgtcaaagaggatggtattgagaaacctcgaatcgtgatgaaaaat
tctcagttcaagcgacacactaacgcggatctggtctacatgactccatcccccgacttt
tgtgaatctgacccactacgtggcatactcggaaccaaaggtcgtcagtgcactcttgca
ccgaatgcgattgatgactgcagtttgctctgttgtggtcgtggatacgagaagaaggtg
caaatagtcgaggagaagtgcaattgcaagttcatctactgctgtgaagtacgatgtgag
ccatgtcagaaacgaattgagaagtatttatgcttataa

DBGET integrated database retrieval system