KEGG   Caenorhabditis elegans (nematode): CELE_K10C9.3
Entry
CELE_K10C9.3      CDS       T00019                                 

Gene name
rnst-2
Definition
(RefSeq) Ribonuclease T2 protein rnst-2
  KO
K01166  ribonuclease T2 [EC:4.6.1.19]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_K10C9.3 (rnst-2)
Enzymes [BR:cel01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.19  ribonuclease T2
     CELE_K10C9.3 (rnst-2)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    CELE_K10C9.3 (rnst-2)
 Prokaryotic type
    CELE_K10C9.3 (rnst-2)
SSDB
Motif
Pfam: Ribonuclease_T2
Other DBs
NCBI-GeneID: 190096
NCBI-ProteinID: NP_503370
WormBase: WBGene00019624
Ensembl: WBGene00019624
UniProt: O61887
Position
V:join(1061597..1061880,1061937..1062062,1065111..1065264,1065313..1065468,1067737..1067856)
AA seq 279 aa
MKLLLLLCISCIPLAYSHDGEPFDYLMFTTIYPTAVCRADDDSVPESCEIPSGTPQWSIH
GLWPNFENGSYPQNCRGTPRHFDENLIKSIEDRLVVVWPNLYPKKTIQSFWKHEYDKHGT
CAQSEKLFESELAYFTEVMKVFDSIDVAGGLKSVGPSEKPITSSDLKNALSGVTSGKTFQ
FHCLRDKKTKQFLLGDIRLCLNKDLTIRDCPTDGKHPNRVSRFERSIGRNRRGPPLPSFQ
PCPAEFIYLPEMSSISKSSDSTSPSIFGRIWSAIKNIGN
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaaacttctccttcttctctgcatatcctgtatacccctagcctattctcatgatggt
gagccatttgactacctaatgttcaccacaatctacccaaccgccgtctgccgtgccgat
gatgattcagtccctgaatcctgtgagattccaagtggtacccctcaatggtcaattcac
ggattgtggccaaactttgagaatggctcgtacccacaaaattgtcgtgggactccaaga
catttcgatgagaatttgataaaatcaattgaagatcgattggtagttgtctggccaaac
ctctaccctaaaaagacgattcaatccttctggaaacacgagtatgataagcacgggaca
tgtgctcaaagtgagaagctcttcgagtcagagttggcttacttcacagaggtaatgaaa
gtcttcgactctatcgatgtggctggaggattgaaatcagttggaccatcggaaaaacca
atcacctcgagcgacttgaaaaacgcgttgagcggagtcaccagcggaaaaactttccaa
ttccattgcctccgggataagaagaccaaacagttccttctcggtgacattcgcttgtgt
ctcaacaaggacttgacaatccgagactgtccgactgatggaaaacatccgaatcgagtc
agcagattcgagagatcaattggcagaaatagacgcgggccaccacttccaagcttccag
ccatgccccgccgagttcatctaccttccggagatgagcagcatttctaaatcctctgat
tccacatcgccatctattttcggacgaatctggagcgctatcaaaaatattggaaattaa

DBGET integrated database retrieval system