KEGG   Caenorhabditis elegans (nematode): CELE_K10D2.3Help
Entry
CELE_K10D2.3      CDS       T00019                                 

Gene name
cid-1
Definition
(RefSeq) Caffeine Induced Death (S. pombe Cid) homolog
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP_assoc NTP_transf_2 Polbeta Fer4_10
Motif
Other DBs
NCBI-GeneID: 175707
NCBI-ProteinID: NP_498099
WormBase: WBGene00019629
Ensembl: WBGene00019629
UniProt: Q09409
Position
III:join(5173992..5174073,5174371..5174828,5174949..5175111,5175162..5175469,5175632..5176624,5176674..5177207,5177290..5178146,5178659..5178767,5178817..5179228,5179560..5179770,5179816..5179936,5180024..5180053)
Genome map
AA seq 1425 aa AA seqDB search
MTDEQRSGSRRRGGALGGGRGGNSQNSGRKRSSNSPADSASSSQKTSRNPSQNRPPMNIV
PQKVTILKRNQDSQPTSPINRNAPPGPLVAAVQPLMAVELGDSGASLKGWNSNPTTPEKT
TINVAGRQAEANKKQTQEYYFSKNAGSAVSAQTFQETVQYPMSSFPLEKNVPIQIDNNFT
LLITPTTSKCNGLFIKVKLQHGDDNITTGALLKLDADEKTIRKSCRETIENLLKAKSSSD
RFPFSKCSEGFLTSCLIKKLVDRLEAFPEAIYYCEKCDYHINTIGHAKAHLESSTHFDDV
KRQEQREHLLKIIPPPTEAHLESVEKVLEGTLKSYQQVRQNGIEIGETIIYYLSTTVFPS
IGLQDVILRPFGSVTYDVTLPDSDYNVAYTMSIPEGTPIFALLEQVRKKIADDGHPADHS
MEMGTPSTIIFTFKGVRVKLCWMSCFNHRIQLHFSELMKTYVNLREEVAQFLQLIRLWAT
KAGLDSKNKPRIGLPRYGFDIMAIHFLQQIGCLPVLHELFEAGPETEKIEEMSAEKTAKL
QSEEAGQRRMRLMSRYEKNTEKIGTKFDLKKSWNLAELFIGFFRYYVERHRDVVIQITQL
IPMSRDVSRWNKKILHVVDPFRGDNVLSIPKVSTWQPFFFNCLLTSFVSFSIPRTKNGPL
IEVSFVHNKTIKPGKKFKDTPKKATVEAPIPLTQIMEEHYQEPVYEIVNDKDHLKYMKEL
KERLMIDGILVNERKPIDYHTDDHRECVYGRNSLLRFKRVLKPGLNGKMAASMDGLSFVT
KKGKKFINRWKKANVIILSEDSSEIDEKTKAADSNVSEIAEKLEETLKISSQKNIDVAVT
SMPVSTEIKPEPITKLSNEAPVKIKNVAQPQCDLIEAPQESLMNESMMESSFDETESPMK
TPIVQKPVKQNATFGKSTISTVIPDKQFCSEEFFIKLNSNLKDIVSKSKSLKPSDFHYEF
STDLFCGDFEMEMKCTHCDGSHCVENCPMMEIPPIKKYQARTPEDLKDIDDMIDKYYHEN
ILDERRLKMLDHKIDELQSFLRKNYREDVTLTTFGSVMTGLSVNCSDIDICLRFGDGDVP
PKDLTAKEVIQKTESVLRKCHLVKRVQAIVTAKVPIVKFQVKLSNGAIIDVDISYYNILA
IYNTALLKEYSLWTPDKRFAKLALFVKTWAKNCEIGDASRGSLSSYCHVIMLISYLQNCD
PPVLPRLQEDFRSDNRERRLVDNWDTSFAQVETSLLQRWPKNKESCAQLLIGYFDYYSRF
DFRNFVVQCRREMILSKMEKEWPRPLCVEDPFDLSHNLSSGVNKKMFVFIMKVFINSRAV
FMSEKPPMNRDHTFLSSYQHQLLRKCNQGSAPTDRQCHQCHRIGHFVESCPQRALAKEAR
KRFGSNSTNSSYRSNDSGRGFKNGEEGGDRLTYHKRTYYHRSYNK
NT seq 4278 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgagcaaaggtctggaagtaggcggagaggaggagcccttggaggtggaagg
ggaggaaatagccagaatagtggccggaaaagatcatcaaacagtccagctgattcggct
tcctcctcccaaaagacgagcagaaatccatcgcaaaatcgtcctccaatgaacatcgtt
cctcaaaaagtcacaattctgaaacgaaatcaggattctcagccaacatctccaataaat
cggaatgcgccaccaggacccttggttgccgctgtacaaccattgatggctgttgaattg
ggcgattcgggagcttcattgaaaggatggaattcaaatcctactactccagagaaaaca
acgattaatgttgctggacgacaagcagaagccaacaaaaaacagacgcaagagtattat
ttctccaaaaatgccgggtcagccgtgtcggctcaaacatttcaagagactgtccagtat
ccaatgagctcatttccgttggaaaagaatgtacctattcaaattgataacaattttacg
ctgttgattactccaactacgagcaagtgcaatggactattcatcaaagtaaaattacaa
catggagatgacaatatcacaactggagctctgttgaaattggatgcagatgaaaagacg
atcagaaaatcttgcagggaaactattgagaatctcttgaaagcaaagtcttcatccgac
agatttccattctcaaagtgttctgagggatttctgacttcttgtttgatcaagaaactt
gtcgatcgtctagaagcgttcccagaggccatatactattgcgaaaagtgcgattatcat
attaatacaatcggacacgcaaaagcacacttagagagcagtacacattttgatgatgtt
aagcgacaggaacaacgggagcatcttttgaaaattattccacctccgactgaagcacat
ttagagagtgttgaaaaagttttggaaggaacattgaaatcgtatcaacaggttcgtcaa
aatggaatcgagatcggtgaaacaatcatctattacttgagtactacagtattcccatcg
attggattgcaagatgtgatacttcgaccatttggatctgtaacatatgacgtcacactt
ccggatagtgattacaatgtggcatatactatgtcaattcctgaaggaactccaatattt
gcattacttgaacaagttcgaaagaagattgccgatgatggacatccagctgatcattcc
atggaaatgggaacaccgtcaacaattatatttacattcaaaggagttcgagttaaactt
tgttggatgtcatgtttcaatcatcgtatacaacttcatttttctgaattgatgaagacc
tatgtaaatttacgagaggaagttgctcaatttcttcaacttattcgtctttgggcaacg
aaagctggccttgactccaaaaataagcctagaatcggacttcctcgatatggatttgat
ataatggccattcattttcttcagcagatcggatgccttccagtacttcatgaacttttt
gaagcaggtccagaaactgagaaaattgaagaaatgagtgctgaaaagacagcaaaactt
caatcggaagaagctgggcaacgtagaatgagattgatgtctcgatatgagaagaatact
gaaaagattggtacgaagttcgacttgaagaaatcttggaatctagctgagctcttcatt
ggcttctttcggtattatgttgaacgacatcgggacgtagtcatccaaattacacagctt
attccaatgagtcgagatgtgagccgttggaataaaaagattcttcatgttgttgatcca
ttccgtggtgacaatgttctttcaataccaaaggtttctacttggcaaccattctttttc
aattgtctcctaacatcatttgtatcgttttcgattccaagaaccaagaatggaccatta
attgaagtttcgtttgttcataataaaactatcaaacctggaaaaaagttcaaggatact
ccaaaaaaggcaacggtggaggcacccattccattgactcaaataatggaagaacattat
caagaacctgtatatgagattgtaaatgataaagatcatctaaaatatatgaaagagctc
aaggaacgtctgatgattgatggaatcttagtgaatgaacgaaaaccaattgattatcac
actgatgatcatcgagaatgtgtttatggtagaaattcacttttgcgattcaagagagtt
ctcaaaccaggactaaatggaaaaatggcagcatcaatggatggattgagttttgtgacg
aaaaaaggaaagaaattcatcaatcggtggaagaaggcgaacgtcatcattttatcggaa
gattcttctgaaatagacgaaaagacgaaagcagctgatagtaatgtgtccgaaattgca
gaaaaattggaggaaaccctcaagatttcttctcaaaagaatattgacgttgcagtaaca
tccatgcctgtttccacggaaatcaagccggaacccatcacgaaattatcaaatgaagca
ccagtgaagataaaaaatgttgctcaacctcaatgtgatctcatagaagcaccacaagaa
tctctaatgaatgaatctatgatggaatccagtttcgatgaaactgaatctccaatgaaa
actccaattgttcagaaacctgtgaaacaaaatgcgacatttgggaaatctacgatatcc
acagtaatccccgataagcaattctgcagtgaagagtttttcattaaattgaattcgaat
ttgaaggatattgtatccaaatcgaaaagtctaaaaccatcagattttcattatgaattc
tcaactgatcttttctgtggagactttgaaatggaaatgaaatgtacacattgtgatggt
agtcattgtgttgaaaactgcccgatgatggaaattccaccgattaaaaaatatcaagca
agaactcccgaagatttgaaagatattgatgatatgattgataaatattatcatgagaat
attcttgatgaacgacggctcaaaatgttggatcacaagattgatgaacttcaatcattt
ttaaggaaaaactatcgtgaagatgtcactcttacaacatttggaagtgttatgacagga
ttaagtgtcaattgttcagatattgatatttgtttgagattcggagatggagatgttccg
ccaaaggatttgacagcaaaagaagttattcagaaaactgaatccgttctcagaaaatgt
catttggtaaagagagttcaagcaattgtcactgcaaaagtgccaattgtcaagtttcaa
gtgaaactttccaatggagcaattattgatgtcgatatctcctactacaatatattggca
atctacaacacagctcttctgaaagaatattcattgtggacgcctgacaaacgttttgct
aaattggctctctttgtgaagacttgggccaaaaattgtgaaatcggagatgcatcacgt
ggatcattgagctcatattgtcacgtcatcatgctcatttcttatcttcaaaactgtgat
ccaccggttcttccacgccttcaagaagattttcgaagtgataatcgggaaagacgactc
gttgacaactgggatacgtcatttgctcaagttgagaccagtttgctacaacgttggcct
aaaaacaaagaatcgtgtgctcagctgctcattggatactttgactattattcgcgtttt
gatttccggaattttgttgttcaatgtcgacgggaaatgatattgtcgaaaatggaaaaa
gagtggccgagacctctttgtgtagaggatccattcgatttgagccataatctgagcagc
ggtgttaacaagaaaatgttcgtattcattatgaaagtgttcatcaactcacgagcagtc
ttcatgtctgagaaaccaccgatgaatcgagatcacactttcctatcatcatatcaacac
cagttacttcgaaaatgcaatcaaggatccgctccaactgatcgtcaatgtcatcaatgt
cataggataggacattttgtagaatcgtgtccgcaaagagccctggcaaaagaagcccgg
aagcgatttggatcaaactcgacaaactcatcataccgatcaaatgatagtggaagagga
ttcaaaaatggagaggaaggtggcgatcgtctgacttatcacaaaaggacatactatcat
cgctcgtacaacaaataa

DBGET integrated database retrieval system