KEGG   Caenorhabditis elegans (nematode): CELE_K11G9.4Help
Entry
CELE_K11G9.4      CDS       T00019                                 

Gene name
egl-46
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-met zf_UBZ Mut7-C
Motif
Other DBs
NCBI-GeneID: 179058
NCBI-ProteinID: NP_504694
WormBase: WBGene00001210
Ensembl: WBGene00001210
UniProt: G5EFY4
Position
V:complement(join(6679657..6679872,6680301..6680462,6680544..6680621,6680942..6681094,6681316..6681567))
Genome map
AA seq 286 aa AA seqDB search
MVPMNDFWVKAILSSTNPSPVPSTTSTVSNDENLDKTLDFDCSTQTVFPTLPMFWNPTLV
QQMLALYQIQQQQIQFSAKLAPQPLFQEPTIQKEFLPFPHQSRKRPLPIDPKKTKLRKLN
EDTVTSSPVSGMFIKEEADVKSVEELQKEADLLDETAAYVEVTEESRQKIDEIPNVIGDC
ICRLCKVKYEDVFKLAQHKCPRIAHEEYKCPDCDKVFSCPANLASHRRWHKPRNELGGSP
PAQSSTIVSCSTCFNSFPTKKMLKLHSSTCQRSPLQDLLSRVIPTM
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctatgaatgacttttgggtcaaagcaatattatcatcgacgaatccgagtcca
gtgccgtctacaacatctaccgtatccaatgatgaaaatttggataaaacgttggacttt
gactgttccacgcaaacagtgttccctacacttccaatgttctggaacccaacgctagtt
caacagatgcttgcgctctaccagatccagcagcagcaaattcagttcagcgcgaagctg
gcacctcaaccgcttttccaagaaccgaccatccaaaaagagtttctcccattcccccat
caatctcgaaaacgtcctctaccgatagacccgaaaaagacaaagcttcgaaaactgaat
gaagacactgtgaccagttctccagtcagcggtatgttcataaaggaggaggcggatgtg
aaatctgtggaggagctccaaaaagaagctgatttgctcgatgagacagcagcatatgta
gaggtcaccgaggagtcaagacaaaagattgacgagattccaaatgtcattggagactgt
atctgccggctgtgcaaggtgaaatacgaggacgtgttcaagctggcacaacacaaatgt
ccaagaattgctcacgaggaatacaaatgtccggattgtgacaaggtgttctcatgtccg
gccaatttggcatcacatcgtcgttggcacaaaccccgtaatgagctcggtggctctcca
cccgcacaatcctcaacaattgtctcctgctccacctgcttcaactcatttccaacaaag
aagatgctcaagctgcactcgtcgacgtgtcaaagatcgcctcttcaggatttgctctca
agagttattccaacaatgtaa

DBGET integrated database retrieval system