KEGG   Caenorhabditis elegans (nematode): CELE_K12C11.2Help
Entry
CELE_K12C11.2     CDS       T00019                                 

Gene name
smo-1
Definition
(RefSeq) Small ubiquitin-related modifier
  KO
K12160  small ubiquitin-related modifier
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CELE_K12C11.2 (smo-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_K12C11.2 (smo-1)
   04121 Ubiquitin system [BR:cel04121]
    CELE_K12C11.2 (smo-1)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_K12C11.2 (smo-1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_K12C11.2 (smo-1)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CELE_K12C11.2 (smo-1)
Ubiquitin system [BR:cel04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   CELE_K12C11.2 (smo-1)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    CELE_K12C11.2 (smo-1)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    CELE_K12C11.2 (smo-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 266820
NCBI-ProteinID: NP_490842
WormBase: WBGene00004888
UniProt: P55853
Structure
PDB: 

Position
I:join(1340703..1340768,1340825..1340925,1340976..1341084)
Genome map
AA seq 91 aa AA seqDB search
MADDAAQAGDNAEYIKIKVVGQDSNEVHFRVKYGTSMAKLKKSYADRTGVAVNSLRFLFD
GRRINDDDTPKTLEMEDDDVIEVYQEQLGGF
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgatgcagctcaagcaggcgacaacgccgaatacatcaagatcaaggtcgtt
ggacaggacagcaacgaagtgcacttccgtgtaaagtatggaacctctatggccaagctg
aagaagtcgtacgctgacagaaccggtgtcgccgtcaacagtcttcgtttcctcttcgac
ggacgtcgcatcaacgacgatgacacaccgaagacgctcgagatggaggacgatgacgtc
atcgaggtctaccaagagcagctgggcggattctag

DBGET integrated database retrieval system