KEGG   Caenorhabditis elegans (nematode): CELE_M02D8.4
Entry
CELE_M02D8.4      CDS       T00019                                 

Gene name
asns-2
Definition
(RefSeq) Glutamine amidotransferase type-2 domain-containing protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00250  Alanine, aspartate and glutamate metabolism
cel01100  Metabolic pathways
cel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_M02D8.4 (asns-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_M02D8.4 (asns-2)
Enzymes [BR:cel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CELE_M02D8.4 (asns-2)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C44
   CELE_M02D8.4 (asns-2)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase QueC
Other DBs
NCBI-GeneID: 181121
NCBI-ProteinID: NP_741864
WormBase: WBGene00019730
Ensembl: WBGene00019730
UniProt: Q21463
Position
X:complement(join(8748610..8748722,8748770..8749472,8749523..8749928,8749977..8750146,8750195..8750284,8750594..8750732,8750780..8750862))
AA seq 567 aa
MCGVFSICQQTCKNKPKYDLDEARKLSRRQHHRGPDFSGCYQDTKTGDILVHERLAIMDL
GVVQPLQGTAPNRQVIHNGEIYNHQELRDTELKKYNLKTHCDSEVIIFLYEKYRDGHICN
LLDGVFAFVLCCDGDFLAARDPLGVKQMYYGIDDDGRYFFSNEMKCLEDSCGDNKIESFP
PGHYYTPKTGFVRYFNPEWFDFRKAIHPLDLKLLQKTMIASVHKRLMSDAPIGVLLSGGL
DSSLVSSIASREMKRRGMAVHSFSIGVDHNSPDVVAARKVAKFIGTTHHEFYFSIEEGIK
NLRKLIWHLESYDVTSIRASTPMYFLSEEIRKLGIKVVLSGEGADEIFGGYLYFHNAPSD
EDFQKETIDRVLHLYTSDCLRADKSSMAHSVEVRVPFLDKAFVEAAVSLDPAFKRPQKLE
DGRNCEKFVLRSAFNTDQYPYLPDEILWRQKEQFSDGVGYSWIDTLMKYCAAKITDKEFS
QASKLFPHNTPHSKEAFYMRKIFHEQFPSEQAALTVRKWIPKWQKNQDPSGRASLVHENS
AHNIGDEFCNNKSAISQHHIEQCRPQA
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgtgcggcgtattctcaatttgccaacaaacatgcaaaaacaagccaaagtacgaccta
gatgaggctcgcaagttgtccagaagacaacaccatcgtggaccggacttcagtggatgc
taccaagacacgaagactggagatatactagtccacgagcgtctagccattatggatcta
ggtgttgttcaaccacttcaaggaacagccccaaaccgtcaggttatacacaacggtgaa
atctacaaccatcaagaactccgtgacaccgagctgaagaaatacaatttgaaaacccat
tgcgattcagaggttattattttcttgtacgagaaataccgtgacggacacatctgcaac
cttcttgatggagtttttgcatttgttctttgttgcgatggagatttccttgctgctcgt
gacccacttggcgtaaaacaaatgtactacggaattgatgacgatggaagatacttcttc
agtaacgagatgaagtgcttggaagatagttgcggagataacaaaatagaatcgttccca
cccgggcactactacactcctaaaacgggattcgttcgctatttcaacccagaatggttc
gacttcagaaaagcgatccatccattggacctcaaacttctccaaaaaaccatgatagct
tcagtccacaagagattaatgtccgatgcaccaattggagttttgctctcgggaggactt
gattccagtctggtctcttcaattgcttcaagagaaatgaaaaggagaggaatggccgtt
cactcgttctccattggtgtcgatcacaactccccagatgttgtggctgctagaaaagtt
gcaaagtttattggaactactcatcatgagttctatttcagcattgaggaaggtatcaag
aacctgcgtaagcttatttggcatcttgagtcttatgatgtcacatccattcgtgcttct
actccaatgtacttcctctccgaagaaatcaggaaattgggaatcaaagttgttctttct
ggagaaggagctgatgaaatcttcggtggatatctctacttccacaatgccccatccgat
gaggactttcaaaaggaaaccatcgatcgtgttcttcatctctacacatctgattgtctt
cgtgctgacaagtcttcgatggctcactcagtcgaagttcgtgttccattcctggataaa
gcatttgttgaggctgcagtcagtttggaccctgcatttaagcgcccacaaaaacttgaa
gatgggagaaactgcgagaagtttgttctccgatcagctttcaacacggaccaataccca
tatctgcctgatgagattttgtggagacaaaaagaacagttctccgacggagttggatac
agctggattgacactctcatgaagtactgtgctgctaaaattaccgacaaggaattctct
caagcctctaagcttttcccacacaatactccacacagtaaggaagcattctacatgaga
aagatcttccacgagcagttcccatctgagcaagcggctctcactgtcagaaaatggatt
ccaaaatggcaaaagaaccaagatccatcaggaagagcatcattggtccatgagaactct
gctcacaacattggagacgaattctgcaacaacaaatctgcaatcagtcaacatcacatt
gaacaatgccgaccacaagcataa

DBGET integrated database retrieval system