KEGG   Caenorhabditis elegans (nematode): CELE_M153.1
Entry
CELE_M153.1       CDS       T00019                                 
Symbol
pycr-1
Name
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00330  Arginine and proline metabolism
cel01100  Metabolic pathways
cel01230  Biosynthesis of amino acids
Module
cel_M00015  Proline biosynthesis, glutamate => proline
cel_M00972  Proline metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CELE_M153.1 (pycr-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     CELE_M153.1 (pycr-1)
SSDB
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH PDH_N IlvN GFO_IDH_MocA NAD_Gly3P_dh_N ApbA DapB_N Semialdhyde_dh 2-Hacid_dh_C OCD_Mu_crystall 3HCDH_RFF
Other DBs
NCBI-GeneID: 181380
NCBI-ProteinID: NP_001348640
WormBase: WBGene00010924
Ensembl: WBGene00010924
Position
X:12146832..12148771
AA seq 293 aa
MKIGFIGAGKMAQALARGLINSGRITADNIIASSPKRDEVFLDQCKALGLNTTHDNAEVV
QKSDVVFLAVKPVHVSKVASEIAPALSKEHLVVSIALGITIRNIESLLPTKSRVVRVMPN
TPSVVRAGASAFAMGSACRDGDAETVEKLLSTVGFAVEVPEIHIDPVTGLSGSGPSYMFA
VIEGLADGGVKVGLPRDLALKLAAYTLLGAAKMVLETGIHPAQLKDDVQSPAGSSVYGMH
KLESGGLKGVLMDAVEAATNRSRATGDKALPRDFRNTEIETEKMMESAQQQRT
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaagatcggatttattggagctggaaaaatggctcaggctcttgccagaggcctcatc
aactcaggcagaatcacagcagacaacattattgccagttcgccaaaacgcgatgaagtg
ttccttgaccaatgcaaggcactagggttgaacactactcatgataatgctgaagttgtg
caaaaaagtgatgttgtgtttcttgccgtcaagccagtgcacgtgagcaaagttgcttct
gaaatcgctccagcccttagcaaagaacatttggtagtttctattgcacttggaatcact
ataagaaatattgaatcgcttctcccaacgaaatctcgagtggtacgtgtcatgccaaat
accccatcagttgttcgcgccggtgcatcagcgttcgccatgggatctgcttgtcgtgat
ggcgacgccgaaactgtagagaaactcttgagcactgttggttttgcagtggaggttcca
gaaattcatatcgacccagtaacaggactctccggctctggaccaagttatatgttcgct
gtgatcgaagggcttgctgacggcggtgttaaagttggacttccacgtgaccttgctctg
aagcttgcggcttatactttacttggagccgcaaagatggttctagaaactggtattcat
ccagctcagttgaaggatgacgttcaaagtcctgcaggttcatcagtatatggaatgcac
aaattggagagtggagggctcaagggtgttcttatggatgctgtcgaggcggctacaaac
cggtcaagggctactggagacaaggcgttgccaagagacttccgaaataccgagatagaa
acggaaaaaatgatggaaagtgcacaacaacaaaggacatga

DBGET integrated database retrieval system