KEGG   Caenorhabditis elegans (nematode): CELE_M18.7
Entry
CELE_M18.7        CDS       T00019                                 

Gene name
aly-3
Definition
(RefSeq) FoP_duplication domain-containing protein
  KO
K12881  THO complex subunit 4
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03013  RNA transport
cel03015  mRNA surveillance pathway
cel03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CELE_M18.7 (aly-3)
  09122 Translation
   03013 RNA transport
    CELE_M18.7 (aly-3)
   03015 mRNA surveillance pathway
    CELE_M18.7 (aly-3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_M18.7 (aly-3)
   03041 Spliceosome [BR:cel03041]
    CELE_M18.7 (aly-3)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     CELE_M18.7 (aly-3)
    TREX complex
     CELE_M18.7 (aly-3)
Spliceosome [BR:cel03041]
 Complex C
  Other components
   EJC/TREX
    CELE_M18.7 (aly-3)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    CELE_M18.7 (aly-3)
SSDB
Motif
Pfam: FoP_duplication RRM_1
Other DBs
NCBI-GeneID: 178157
NCBI-ProteinID: NP_001076697
WormBase: WBGene00000122
Ensembl: WBGene00000122
UniProt: Q21559
Position
IV:join(12123314..12123521,12123572..12123691,12123739..12123830,12124247..12124373,12124424..12124599)
AA seq 240 aa
MVKATNVDLSLEDIISKTRKTTGSIQKKSFGGARRGNTRPTGLPRRSGGSGGWKDLDAVQ
NHGISSRGNDSKVIRVNISNLAPTVISSDLEELFGDYRLSSVSVNFNEHGDSLGTGDISL
TKRDAERLVQKFSGVALDGKIMKFAVIDSSNMAGRVDFGNRSRSSPGRSSRGFQSGPRRN
NGKPEDFLRDGVHAGDIKRGGAGRGGFRKGGRGGARDAKPKKTEAELDAELEAYMAKRNA
NT seq 723 nt   +upstreamnt  +downstreamnt
atggttaaggctaccaatgtcgatttgtctcttgaggacatcatctctaaaaccagaaag
acaactggaagcattcaaaagaaatccttcggaggagctcgacgaggaaatacgagaccc
actggacttccacgccgctccggcggaagtggtggatggaaagacttggacgcggttcag
aatcatggaatttcaagcagaggaaatgatagcaaggttattagagtaaatatctctaat
cttgccccaacagtcatttcaagcgatttggaggaactcttcggcgactacagactcagc
tcagtttcggtcaacttcaacgagcatggtgattcattgggtactggtgacatttcgctc
accaaacgtgatgctgagagacttgttcagaagtttagcggtgtcgctctagatggaaag
atcatgaaattcgccgtcattgattcgagcaacatggctgggagagtcgattttggaaac
agatctcgtagttcaccgggaagatcatctcgtggattccaatcgggtcctcgcagaaac
aatggcaaaccagaagatttcctccgcgacggagtgcacgccggtgacatcaagagaggc
ggagctggtcgaggtggattccgcaagggaggccgtggtggagctcgtgatgcaaaacca
aagaagaccgaagctgaactcgacgcggagctcgaagcctacatggcgaagcgaaatgcc
tga

DBGET integrated database retrieval system