KEGG   Caenorhabditis elegans (nematode): CELE_R06C1.3Help
Entry
CELE_R06C1.3      CDS       T00019                                 

Gene name
wve-1
Definition
(RefSeq) WAVE (actin cytoskeleton modulator) homolog
  KO
K06220  WAS protein family
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    CELE_R06C1.3 (wve-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WH2 FliD_C
Motif
Other DBs
NCBI-GeneID: 187639
NCBI-ProteinID: NP_001251761
WormBase: WBGene00006958
Ensembl: WBGene00006958
UniProt: Q9XVK6
Position
I:complement(join(11925275..11925535,11925706..11925783,11927121..11927447,11928718..11929321,11929371..11929507))
Genome map
AA seq 468 aa AA seqDB search
MPLTKRAVSPVNLSRGTIPSTIHRDELQCTANGTIANLVRQLSSLSKHAENIFGEIYHDA
MIINHKSNTLQQRIDRLHKKVEDLDSNSDQATLNEANMRKAFKSSMLVDQHILDRSTLPT
ALTEIYAKCDPPPDLDALNPYRDSEIPALSLYTNPSFFFDLWKKETLKEVAERPRRVKSP
NDGSKSPKKRRKQPGQGPLGTTAYNDMQHRNRQISGSRINQQNEVFSFPEEYQAPQALGL
QLNFKNQHPSNMVAPIGMTMHHHPQQNVHPSQQRGGAPAAARGSPNVKRPTEAPPPVNLD
HLPPPDMSILSIDDDDDDLPPPPPPLLMNTSIVHQLPAEAPSTIQFVEPSAAPPTNIPPP
PPPPPPMVISSAAASFAAPAPKPSADGEAAGTNSPVAPKQPDARSDLLAQIQSGIKLKKV
QRAEAEAAENAALEANNVAAILKRRMDQVMGNDDSSSEEGADDDEWDD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaacaaaacgggcggtatcaccggtaaacctcagcagaggcacaattccatca
acaatccatcgtgatgagcttcaatgtactgctaatgggacaatcgccaatttagtacga
caattgagctcgttgagtaagcacgctgagaacatcttcggagagatttatcacgacgca
atgataataaatcacaaatcgaacactcttcaacagagaattgatagattgcacaagaaa
gttgaagatttggattcaaattccgatcaagcaacgttgaatgaagcgaatatgcgaaaa
gcattcaaaagttcaatgcttgtagatcaacatattctggatagaagcactttacctaca
gcattgactgaaatatatgcaaaatgtgatccaccgccggatcttgatgctctaaatccg
tatagagactctgaaatccctgcgctctctctctacacaaatccctcgtttttcttcgat
ttatggaaaaaggagacactaaaagaggttgccgaacggcccagacgggtaaaaagcccg
aacgacgggagtaaaagcccgaaaaagcggcggaagcagcctggacaaggccctctcggc
acgacggcctataatgatatgcagcataggaatcgacagattagtggatcacggattaat
cagcagaatgaagttttctcgttcccggaggaatatcaggctccgcaggctctcgggctt
cagcttaactttaaaaatcagcacccctccaacatggttgccccaatcggaatgacaatg
caccatcatcctcaacaaaatgtgcatccgagccaacaacgaggtggtgctccagcagca
gctcgtggatctccgaatgttaaacgtccgactgaagctccgccgccagtgaatctggat
cacctcccaccaccggatatgtcaattttatcgattgatgatgatgatgatgatcttcca
ccaccaccaccaccgcttctcatgaatacatcaattgtacatcagttaccagcagaagct
ccgtcgacgatacagtttgtcgagccgagtgctgctccgccgactaatatccctccacca
cctccaccaccacctccaatggttataagctcggctgcagcgtcatttgcagctccggct
ccaaagccatccgcggacggtgaagctgctggcacaaattccccagttgctccaaaacaa
ccagatgctcgaagtgatcttttggctcaaattcaatctggaataaagctgaaaaaagtg
caaagagccgaggcagaagccgccgagaatgctgctctcgaggcgaataatgttgcggcg
atattgaagagacgaatggatcaagttatgggaaatgatgattcaagtagtgaagaagga
gctgatgatgatgaatgggatgattaa

DBGET integrated database retrieval system