KEGG   Caenorhabditis elegans (nematode): CELE_R06C7.8Help
Entry
CELE_R06C7.8      CDS       T00019                                 

Gene name
bub-1
Definition
(RefSeq) Mitotic checkpoint serine/threonine-protein kinase bub-1
  KO
K02178  checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_R06C7.8 (bub-1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_R06C7.8 (bub-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_R06C7.8 (bub-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: Other
  BUB family
   CELE_R06C7.8 (bub-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     CELE_R06C7.8 (bub-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Mad3_BUB1_I Kdo Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 172468
NCBI-ProteinID: NP_492051
WormBase: WBGene00000275
Ensembl: WBGene00000275
UniProt: Q21776
Position
I:join(7251947..7252020,7252066..7252595,7252639..7253550,7253595..7253782,7253828..7254597,7254642..7255131)
Genome map
AA seq 987 aa AA seqDB search
MSHIRVAFAPLDTNPSTCGLETFATQIETLSQMMTAEEMKAELYDCVRRILREQKFDQIR
ENEAMLRLYKVMGRSSTNLKGRGIYEQLFKKDHFTGSLKFYLQWAEECGKDQMLEEFKDV
LKLARDRLSERIEMTAIESGFRDLVDEYFNGESGDMFTRPDETMDLFRFNAGSKKKRRSS
VCFLQHNVPINNSGKAAFGPKTKTDLRQACIDRPNYHGISIEEFRFAKWKDTFGEDVDDD
YRKRKDSGVVFVKHQVIDTDRQAREEVENRFNANLNPRRRHLSPVSEKTVDDEEEKRSRI
YSPLVATKDAHRPALRSKIENPPATVTLSSDTKSASEKDVSDSDDADDDERLKIMTAGRK
DGNPPDRSTSISSNYSTASARTSKSGAGLDLMAENKCLEAHAMFSDTVHLASEKTMVLGD
DSVFVPERSLATTQIVTDFSVLCDPDPTMTITQERPKKVSNGLNVVYDEAAEPEESQKVE
ESEVQPEIVLVSPVTQTSPATMFNDIYDDEIEFGFFKPSRGNFVTSTPAQGVHLVNIDEY
FGNKEEESTHEQEAPVFVAPTSSTFSKLTRRKSLAANQAVQPSVTESSKPERSDPKDSSI
DCLTANLGRRLSIGADEIPNLTENNESEITGCKIRRRSEIIKQGDINPWDETLRKKLMCL
VRPPQNMHEFQERAPKIQALRDCEVSGEKLHIQTLIGQGGYAKVYRAVTDDQRTVAVKYE
VPSCSWEVYICDQMRNRLKDRGLELMAKCCIMEVMDAYVYSTASLLVNQYHEYGTLLEYA
NNMKDPNWHITCFLITQMARVVKEVHASKIIHGDIKPDNFMITRKIDDKWGKDALMSNDS
FVIKIIDWGRAIDMMPLKNQRFKGRAGTEAFDCPEMVDGRSWTYQADYFGFAATMAVVVA
GKYAQLTGASVGDYSLNVDIKRRNILRDACYDVINRFLNIPSCDSLPDWNILIKSFSEIW
NEKFEASGWRQAVSKFNEACDLAANQK
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacattagagtggcattcgctccactcgacaccaatccgtcgacatgtggtctt
gagacgttcgcaacgcaaatcgaaacgttgtctcaaatgatgaccgcggaggaaatgaag
gcggaattatacgactgcgttaggagaattttgcgggagcaaaagtttgatcaaattcgt
gaaaacgaagcgatgctccgtctctacaaagttatgggtcgatctagtacaaacctgaag
ggaagaggcatttatgaacaacttttcaaaaaggatcatttcactggttcgctgaagttc
tatctgcaatgggcagaagaatgtggaaaagatcaaatgctggaggaattcaaagatgtc
ctgaagttggcacgagatcgtctttccgaaagaatagaaatgacagcaattgaatcggga
tttcgcgatttggtcgatgaatacttcaatggagaatctggagatatgttcacacgaccg
gatgagactatggatcttttcagattcaatgcgggttctaagaaaaagcgtcgctcttcg
gtttgctttttgcaacacaatgtgcctataaataactcgggaaaagctgcatttggacca
aaaaccaaaacggatcttcgccaggcgtgtatcgacaggccaaactatcatggaatatcg
attgaggagtttcgttttgccaaatggaaggacactttcggagaagatgttgatgacgat
taccgaaaacgaaaagactctggtgtcgttttcgtgaaacatcaagtcattgataccgac
agacaagcccgcgaagaagttgaaaaccgattcaacgccaatctaaatcctagaagacgt
catctttcaccagtcagtgagaaaacggttgatgatgaggaggaaaagcgaagccggatt
tattcgccgctggttgcaacgaaggatgctcacagacctgcacttcggagcaaaattgag
aatcctccagcgacagtgacactttcgtcggatacaaagtctgcttcggagaaagatgtt
agtgattccgatgatgcagatgatgatgaaagactcaagattatgactgccggcagaaaa
gatggtaaccctccagaccgttccacaagcatatcttccaactattcaactgcttctgca
agaacatcaaagagtggagctggattggatttgatggcggaaaataagtgtttggaggca
catgctatgttttccgacactgtacatcttgctagcgaaaagacaatggtccttggcgat
gattctgtcttcgttccagaaagatctttagctactacgcagatagttactgacttttcc
gtgctctgtgatcctgatccgacaatgaccattacacaggagcgtccgaaaaaagtgtcg
aatgggttgaatgttgtttacgatgaggcagccgaaccggaagaatctcagaaagttgag
gaatctgaagtacaacccgaaattgtcctagtttctccagtgacgcaaacctcaccagct
acaatgtttaatgatatttatgacgatgaaatcgagtttggctttttcaaaccgtctcgt
ggtaatttcgtcacatcgacccccgcacaaggagttcatttggtcaacattgatgaatat
ttcggaaataaagaggaggaaagcactcacgaacaggaagctccagtatttgttgctcca
accagcagtactttcagtaaattaacacgtcgaaagtcactagcagcaaatcaagccgtt
cagccctcagtcacagagtcatcaaagcctgaacgatcagatcctaaagattcatctatc
gattgtttgacagctaatctaggaagacgtctttcaattggtgctgatgaaattccaaat
ctcactgaaaacaacgaatctgaaatcactggttgcaagattcgtcggcgcagtgaaatt
atcaagcaaggagacatcaatccatgggacgaaactcttcgaaaaaaattgatgtgtctt
gtgcgtcctccccagaatatgcacgagttccaagaacgagcaccgaagattcaagctctg
agagactgcgaggttagcggagaaaagctccacattcaaactcttattggtcaaggtgga
tacgctaaagtataccgggctgtaaccgatgatcaaaggacagtagctgtgaagtacgag
gtgccatcatgttcgtgggaagtgtacatttgcgaccaaatgcggaatcgcctgaaagat
cgaggtttggagctgatggccaaatgttgcattatggaagtgatggatgcttatgtttat
tcaactgcttcgcttcttgttaatcagtaccacgaatatggaacgctgcttgaatatgcg
aataacatgaaggatccgaattggcacataacctgcttcttgattacccaaatggcccga
gttgtgaaggaagtccatgcctctaaaattattcatggagatatcaaaccggataatttt
atgatcaccagaaagatcgatgataaatggggcaaagatgctctgatgagtaacgacagc
tttgtcatcaagattatcgactggggacgtgccattgacatgatgccactgaagaaccag
cgtttcaagggaagagcaggaacagaagcgtttgattgcccggaaatggttgacggtcgt
tcttggacttaccaagccgattacttcggattcgccgcaacaatggctgtcgttgttgca
ggaaagtatgcacagttgactggagctagcgttggagactattcgttaaatgtcgacatc
aagaggcgcaacattcttcgcgatgcttgctacgatgtcattaacagattcctcaacatc
ccttcgtgtgattcacttccggactggaatatcctgatcaagtctttctcggaaatctgg
aatgaaaagtttgaagcatcgggatggcgacaggcggtttccaagttcaatgaggcctgt
gatcttgccgccaaccaaaagtag

DBGET integrated database retrieval system