KEGG   Caenorhabditis elegans (nematode): CELE_R07E4.6
Entry
CELE_R07E4.6      CDS       T00019                                 

Gene name
kin-2
Definition
(RefSeq) cAMP-dependent protein kinase regulatory subunit
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: cNMP_binding RIIa Cupin_2 DUF5586 DUF5449
Other DBs
NCBI-GeneID: 180864
NCBI-ProteinID: NP_001076771
WormBase: WBGene00002190
Ensembl: WBGene00002190
UniProt: P30625
Position
X:complement(join(5971695..5971867,5972231..5972434,5972501..5972615,5972660..5972773,5972820..5972933,5972998..5973204,5977592..5977674,5977734..5977854))
AA seq 376 aa
MNNYSGDIVFMSGGNEEDQLAQCQAYVQRHNIQQLVKEAIVVLCIHKPDNPVLFLKDHFE
KLNEQRAQEGGNPDAADDDDIIVEPPKRSGGRRTGISAEPIKEDDTEYKKVVIPKDDATR
RSLESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVY
VNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKM
YDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQK
RSDDAPFDVVGHLGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREI
LKRDVSNYNSYVKLMT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaacaattattcaggtgacattgtttttatgtcgggtggaaacgaagaggatcagttg
gcacaatgccaggcctatgtgcaacgacacaacattcagcagcttgtcaaagaagcaatt
gttgttctgtgcatacacaaacccgacaacccggttctcttcttgaaggatcattttgaa
aaactcaacgaacaacgagcacaggaaggaggaaatccggacgctgctgatgatgacgac
atcattgtggagccaccaaagagatcaggtggacgcagaaccggaatctctgccgaacca
atcaaggaggacgataccgagtacaagaaggttgtgattccaaaggatgatgctacaaga
aggtcgcttgagtcagccatgaggaagaacttgctctttgctcatttggaggaggatgag
caaaaaaccatgtacgatgccatgttcccagttgagaagtctgctggagagaccatcatc
gaacagggagaagaaggagataacttctatgttattgataagggaaccgttgatgtctac
gtcaatcacgagtacgttctcaccatcaacgagggtggatcatttggagaacttgctttg
atctatggaactccacgtgctgcaaccgtcattgccaagaccgacgtgaaattgtgggcc
atcgaccgtctcacctaccgtcgtatcttgatgggatcagtaacaaagaagagaaagatg
tatgacgagttcctctccaaggttcaaatcttggccgatctcgaccagtgggagcgcgct
aacgtggctgatgctcttgagagatgcgacttcgagccaggaactcatgtcgtcgagcaa
ggacaacccggagacgaattcttcatcattctcgagggagaagccaatgtgttgcagaag
agaagcgacgacgcaccattcgacgttgtcggacatcttggaatgtcggactatttcgga
gaaatcgctcttcttctcgaccgcccacgtgccgccaccgttgttgccaaaacccatctc
aagtgcatcaagctggatcgtaaccgcttcgaacgtgtcatgggaccagttcgtgagatc
ctgaagagagacgtttcaaactacaactcatacgtcaaactgatgacctaa

DBGET integrated database retrieval system