KEGG   Caenorhabditis elegans (nematode): CELE_R07H5.2Help
Entry
CELE_R07H5.2      CDS       T00019                                 

Gene name
cpt-2
Definition
(RefSeq) Carnitine Palmitoyl Transferase
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00071  Fatty acid degradation
cel01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CELE_R07H5.2 (cpt-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     CELE_R07H5.2 (cpt-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 178025
NCBI-ProteinID: NP_001040977
WormBase: WBGene00011122
Ensembl: WBGene00011122
UniProt: G5ECS9
Position
IV:join(11179645..11179811,11179867..11180122,11180398..11180531,11180580..11180709,11180761..11180920,11180969..11181113,11181160..11181236,11181284..11181704,11181757..11182123,11182733..11182816)
Genome map
AA seq 646 aa AA seqDB search
MLRSSNLCRSITASRGKHALTGDDYQYLEKSEIPSYHFQKSLRRLPIPKLPDTVNRYLAS
SKAVLSPDVFAKTEATIRSFEANEGPKLQEALLEYDKAHRDTSYISEPWFDMYLRARVPV
AVNYNPFMMYAPDPNPKFNDQLTRATNLAISYARIKRSLDENLLGPEVFHMNPKKSDTKL
FRTVCKTLPPSLSWFGAVAFKAFPLDMSQYKSLFCGSRIPKKEKDMLYLDASQKHFVAFY
KGHPYAVRIFDDDGKLLDAEDVHASLAWILSNGKEAAPESSIGSLTSLDRDSWAEARVEL
ENAGNGEYLKKIDGGLFAICLDDLKTEEHKRLVQSLLIGDDARNRWFDKCFQTIIDANGQ
ATINFEHSWGDGVAVLRLMEESFKDTNKNHFVSPDDTPKSHNPAHVQALEFKLTDSLKSK
ISDAQKKHVSANSDLDFATMEFEGLNRDLIKKTKLSPDSVMQLAIQMAFYSLYKEFVPTY
ESCSTAAFLKGRTECMRSATSATRAATLAILEENRKDVRQLLTDCSTQHFQLVKEASMGQ
GYDRHLLGLKITAQRLSQPTPDFFQDPGYTRMGHFVLSTSTLSTDTIVFGGFGPVVQDGF
GIGYNVVPNKLGAVISSNKSKRDAAAFSNALYKSLDILRGHLLDPK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgttcctcaaacttgtgtcgatcaattacagcttctcgtggaaagcatgctttg
accggagacgactatcaatatctggaaaaatcagaaattccatcgtatcacttccagaag
tcgctgagaagactgcctatcccaaagcttccagatacggtaaatcgctaccttgcttct
tctaaagcagtgctctctccggatgtttttgcaaaaactgaagccaccattcgcagtttt
gaagccaatgaaggtccaaaacttcaagaagcgcttctagaatacgacaaggctcatagg
gacaccagttacatttctgagccatggtttgatatgtatctaagagccagagttccagtt
gctgtgaattacaacccatttatgatgtatgctccagatccaaatccgaaattcaatgat
cagctaactcgcgccacgaatctcgccatttcctatgctagaatcaagcgatccctcgat
gagaacctcttggggccagaggttttccatatgaacccgaaaaagagcgatacaaaatta
ttcagaaccgtttgcaaaactcttccaccaagtctctcatggttcggtgcagttgcattc
aaagctttcccacttgacatgtcacagtataaatctttattctgcggatcgcgaattcca
aagaaagaaaaggatatgctgtatttggatgcctctcaaaagcatttcgttgcgttctac
aaaggtcatccatacgcagttcgtatctttgacgatgatggtaaactccttgatgctgaa
gacgttcatgcatctctcgcttggattttgagtaatggaaaggaagcggcaccagagagc
agtattggatccctaacgtcgttggatcgtgactcgtgggctgaagctcgagtggaactc
gaaaacgcaggaaatggagaatatttgaagaaaattgatggtggacttttcgcaatttgt
cttgatgacctcaaaactgaagaacataaaagactcgtccaatctcttctcatcggagat
gatgctcgtaatcgttggtttgacaagtgcttccagactatcatcgatgccaacggtcaa
gccacaatcaactttgaacactcgtggggagatggagttgccgtgcttcgtttaatggaa
gaatcattcaaggataccaacaaaaatcattttgtatctccagacgacactccaaaatct
cataatccagcacatgtgcaggcactcgaattcaagctcacggattctctcaaatctaaa
atcagtgatgctcagaagaaacacgtctctgcaaattctgatcttgattttgcgacaatg
gaattcgaaggactcaacagagatttgatcaagaaaactaaattgtcaccggattctgtg
atgcagcttgctattcaaatggcattctattctttgtacaaagagtttgttccaacgtat
gagtcatgttccactgctgctttcttgaagggaagaactgaatgcatgagatcggcaaca
tcagctacgcgtgccgccaccttggctattcttgaagaaaatcgtaaagatgttcgacaa
ctattgactgattgctccacacaacatttccaacttgtaaaagaagcatcaatgggacaa
ggatatgatcgacatttgctcggcctcaaaatcacagctcaacgattgagccaaccaact
ccagatttcttccaagatccaggatacacgagaatgggtcattttgtactttcaacgagc
actttgtcaacggatacgattgtcttcggaggattcggaccagttgtgcaagatggattc
ggtattggatacaacgttgttcccaacaaactcggagccgttatttcgagcaataagtcg
aaacgtgacgctgccgccttctcgaatgctctttacaagagtttggacattcttcgtggt
caccttctcgatccgaaataa

DBGET integrated database retrieval system