KEGG   Caenorhabditis elegans (nematode): CELE_R09D1.1
Entry
CELE_R09D1.1      CDS       T00019                                 

Gene name
chil-15
Definition
(RefSeq) Glyco_18 domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Glyco_hydro_18 IL1
Other DBs
NCBI-GeneID: 187731
NCBI-ProteinID: NP_496021
WormBase: WBGene00011157
Ensembl: WBGene00011157
UniProt: Q21857
Position
II:complement(join(9442168..9442981,9443084..9443363,9443418..9443622))
AA seq 432 aa
MSTSSDDVSLFYYDKKASEDVRSLKQILKHFLIIYTVLIACGVFAYAITSLLFHLNHNPT
TLDKAMPTEHPDCNKRIIGYYSENETTDITKRQLSQLTHAIFAFIKLQPDGTLQFQSGSA
KQRFLILKTNAESSTLKVMISIGGMDINSDFSLVISDEKKRRSLIESIVSFLTEHQIDGV
DIFWKWSSSRDKFNFSVFMRDLREKLDKQLKSYIVSILLPPAGVDIWEMGYDLDEIIDHI
DFMNVYSMDYSGPWDNKWGTPTGPSAPMNYNIGPRKHFTVDWTMKYYACKTRQPNKFNIV
IPFYARIWRSVGEAITLKTEVFRNAKLINGKADGDPYISRLSVKQKGIELFPYSWDNATK
SSYIWKPKEKTFLTFENERSIEKKLQYVNEMNLGGVWIWSVDMDDRINTLLDAVSSDKFC
SSSSANSINFKF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgtcaacatcatccgacgatgtttcgttgttttattatgataagaaagcaagtgaagat
gtcaggtcactgaagcagattttaaagcattttttgataatctacactgttctaattgct
tgcggagtttttgcatatgccatcacatcattacttttccacttgaatcacaacccaaca
acattggataaagctatgcctacagaacatcccgattgcaacaaacgaataattgggtat
tactcggagaatgagacgactgatatcaccaaacgacaactatctcagttaactcatgcg
atatttgcattcataaaacttcagcctgatggaacactacagtttcagagtggttcagca
aagcagagatttcttattttgaaaactaatgcggaaagttcaactttaaaagtgatgatt
tcaattggtggcatggatattaattcagacttttcattggttatttcagatgagaagaag
agaagatctctgatcgagtctattgtttcatttctaacagaacaccaaatcgatggagtc
gacatattttggaaatggtcatcaagtcgggataaattcaatttttctgtattcatgcgc
gatctccgtgaaaaattggacaaacaactgaaatcctacattgtatctatactgcttcct
cccgccggagtcgatatttgggaaatgggttatgatttggatgaaatcattgatcatatt
gattttatgaatgtctactcaatggattacagcggaccatgggataataaatggggaacc
cctactggtccttccgccccaatgaactataatattggtccgagaaaacatttcactgtg
gattggactatgaaatactatgcatgcaaaacaagacaaccaaacaaatttaatattgtg
attccattttacgcaagaatatggagaagtgttggagaagcaataactttgaaaactgaa
gtattcagaaatgcgaaattaatcaatggcaaagctgatggagatccgtatatatcacga
ttaagtgttaaacaaaagggaattgaattatttccctactcttgggataatgcaactaaa
tcttcttacatctggaaacccaaagaaaaaacttttctgacatttgaaaacgagagaagc
atcgaaaaaaagctccaatacgtaaatgaaatgaacttgggaggagtatggatttggtca
gtggatatggatgatagaatcaacactcttctcgatgctgtttcttctgataaattttgt
tcttcaagttctgcgaattcaattaattttaaattctaa

DBGET integrated database retrieval system