KEGG   Caenorhabditis elegans (nematode): CELE_R107.8Help
Entry
CELE_R107.8       CDS       T00019                                 

Gene name
lin-12
Definition
(RefSeq) Protein lin-12
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EGF Ank_2 hEGF Notch Ank Ank_3 Ank_4 Ank_5 NOD EGF_CA NODP EGF_2 EGF_3
Motif
Other DBs
NCBI-GeneID: 176282
NCBI-ProteinID: NP_499007
WormBase: WBGene00003001
Ensembl: WBGene00003001
UniProt: P14585
Structure
PDB: 

Position
III:complement(join(9060402..9060524,9060912..9061259,9061570..9063493,9063542..9063670,9063717..9063849,9064154..9065270,9066723..9066913,9067929..9067985,9069601..9069719,9071240..9071388))
Genome map
AA seq 1429 aa AA seqDB search
MRIPTICFLFLLISLSKSLHIGSCLGLICGRNGHCHAGPVNGTQTSYWCRCDEGFGGEYC
EQQCDVSKCGADEKCVFDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKTQGWCYP
SVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVC
PQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKASSKCQCPPGY
HGSTCELLEKEDSCASNPCSHGVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGS
KCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGI
LCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCM
HTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGFC
VCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDIC
ERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINE
EEKGRKCECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKCSERANDGNCDADCNYAA
CKFDGGDCSGKREPFSKCRYGNMCADFFANGVCNQACNNEECLYDGMDCLPAVVRCPVKI
REHCASRFANGICDPECNTNGCGFDGGDCDNETNATIITNIRITVQMDPKEFQVTGGQSL
MEISSALRVTVRIQRDEEGPLVFQWNGESEMDRVKMNERQLTEQHVLSTSISRKIKRSAT
NIGVVVYLEVQENCDTGKCLYKDAQSVVDSISARLAKKGIDSFGIPISEALVAEPRKSGN
NTGFLSWNALLLIGAGCLIVMVVLMLGALPGNRTRKRRMINASVWMPPMENEEKNRKNHQ
SITSSQHSLLEASYDGYIKRQRNELQHYSLYPNPQGYGNGNDFLGDFNHTNLQIPTEPEP
ESPIKLHTEAAGSYAITEPITRESVNIIDPRHNRTVLHWIASNSSAEKSEDLIVHEAKEC
IAAGADVNAMDCDENTPLMLAVLARRRRLVAYLMKAGADPTIYNKSERSALHQAAANRDF
GMMVYMLNSTKLKGDIEELDRNGMTALMIVAHNEGRDQVASAKLLVEKGAKVDYDGAARK
DSEKYKGRTALHYAAQVSNMPIVKYLVGEKGSNKDKQDEDGKTPIMLAAQEGRIEVVMYL
IQQGASVEAVDATDHTARQLAQANNHHNIVDIFDRCRPEREYSMDLHIQHTHQPQPSRKV
TRAPKKQTSRSKKESASNSRDSTHLTPPPSDGSTSTPSPQHFMNTTHTTPTSLNYLSPEY
QTEAGSSEAFQPQCGAFGNGEMWYTRASTSYTQMQNEPMTRYSEPAHYF
NT seq 4290 nt NT seq  +upstreamnt  +downstreamnt
atgcggatccctacgatttgttttttatttcttcttatctcgttatcaaaatcgcttcat
attggctcatgtcttggcttaatatgtggaagaaatggtcactgccatgctggacctgtc
aatggaactcaaacttcttattggtgcagatgcgatgaaggatttggtggtgaatattgt
gaacaacagtgtgatgtttcaaaatgtggagccgatgagaaatgtgtttttgacaaagat
tatcggatggagacctgtgtctgtaaagattgcgacattaacggaaacagtctactaaaa
ccaagctgtccatccggttacggaggagacgactgtaagacacaaggatggtgttacccg
tctgtctgtatgaatggtggacagtgtattggagctggaaatcgagcaaaatgtgcatgt
ccagatggatttaagggggagagatgcgaacttgatgtcaatgaatgtgaagagaacaaa
aatgcatgtggaaataggagtacttgtatgaatacgctcggtacatacatttgcgtgtgt
ccccaaggattccttcctccggattgtctaaaacctgggaacacatcgaccgtcgaattc
aagcaaccagtttgttttctagaaatctcagcagatcatccagatggacgaagtatgtac
tgtcaaaatggtggattttgtgataaggcctcgtcgaaatgccagtgtccacctggatac
catggaagtacttgtgagttgttggagaaggaagattcatgtgcatcaaatccttgttct
catggagtttgtatttcattttctggaggatttcaatgtatttgtgatgatggatatagt
ggatcttattgtcaagaaggaaaggataattgtgtgaataataaatgcgaagctggatca
aaatgtatcaatggagtgaattcatatttctgtgattgcccaccagagagaaccggacca
tattgtgaaaagatggattgttctgcaattccagatatttgcaatcatggaacctgcatt
gatagtcctctatctgaaaaagctttcgagtgtcaatgtgaaccaggttatgagggaatt
ctctgtgaacaggataaaaacgaatgcctttcggaaaacatgtgcctgaataatgggaca
tgtgtcaatctgccaggctcatttcgatgcgattgtgcacgtggattcggtgggaaatgg
tgtgacgagccattgaatatgtgtcaagattttcactgtgagaatgatggaacttgtatg
cacacttctgatcactcacccgtatgtcagtgtaaaaacggatttattggaaaacgatgt
gaaaaggaatgtccaatcggattcggaggtgttcggtgtgatcttcgattggaaattgga
atatgctcacgacaaggtggaaagtgtttcaatggaggaaaatgtcttagcggattctgt
gtttgtccacctgattttactggaaatcagtgtgaagtcaacagaaaaaatgggaaaagc
tcgttatcagagaacctgtgtctatcggatccatgtatgaacaatgccacgtgtatcgat
gtagatgcccatattggatatgcatgtatatgtaaacaaggattcgaaggagatatttgt
gaaagacataaagatctttgtctcgagaatccatgctccaatggaggagtttgccatcaa
catcgtgagtcattctcatgcgattgcccgccagggttctatggaaatggttgtgaacag
gaaaaaatgttccgctgtctcaagagcacttgccaaaacggaggagtttgtattaatgaa
gaagagaagggaagaaaatgtgaatgttcatatggatttagtggagccaggtgtgaagaa
aaaatcaatttgactgggtttaccgagaaagacagccttctgcgatcagtttgcgagaaa
agaaaatgctccgagagagctaacgatggaaactgtgatgctgactgcaactatgctgca
tgtaaattcgacggaggtgactgttcaggaaaacgggaaccattttccaagtgtcgatat
ggaaatatgtgtgctgatttttttgcaaatggagtttgtaatcaagcttgtaacaatgaa
gaatgtctttacgatggaatggattgtttacctgcagttgttagatgtccagttaagatt
cgagaacattgtgcttcaagatttgcaaatggaatctgtgatccagaatgtaatacaaat
ggatgtggttttgatggtggtgattgtgataatgaaacgaatgccacaattatcacaaat
attcgaatcacagttcaaatggatcctaaagaatttcaagtaaccggaggtcaatcactt
atggagattagttcagctcttcgtgtaactgtccgaattcaaagagatgaagaaggacct
ctcgtgtttcaatggaatggggaatctgaaatggatcgagtcaaaatgaatgagagacag
ctcaccgagcaacatgttctttccacatcaatttccagaaaaatcaagagaagtgcaacg
aatattggagttgtcgtctatttggaagttcaagagaattgtgatacaggaaaatgtctc
tacaaggatgctcaaagtgttgttgactcaatatctgcaaggcttgcaaagaagggaatc
gattcttttggtattccaatctcagaagctcttgtcgcagagccaagaaaatctggaaac
aatacaggattcttatcatggaatgctcttcttctaattggtgctggatgtctgattgtt
atggttgttctgatgttaggagcattacctggaaatcggacaaggaaacgtcgaatgatc
aacgcctctgtctggatgccacctatggagaatgaggagaagaatcggaaaaaccatcaa
tcaataacttcaagtcagcattcacttctggaagcttcttatgatggttatatcaaaagg
caaagaaatgaactgcaacactattccttgtatccaaatcctcaaggatacgggaatgga
aatgatttccttggtgatttcaaccataccaatcttcaaattccaactgaacctgaacct
gaaagccccatcaaactacacacagaagctgcaggaagctatgcaattactgagcctatt
actagggaatccgtgaatattattgatccaaggcacaatagaacggttttgcattggatt
gcatcgaattcctcagccgaaaagtcagaagatttgattgtacatgaagctaaagaatgt
attgcggcaggagccgatgtgaatgctatggattgcgacgagaacaccccattgatgctg
gctgttcttgcaagaagacgacggcttgtggcttatctgatgaaagctggagccgatcca
accatctacaataaatctgaacgaagtgctcttcatcaagcggctgcaaatcgagatttt
ggaatgatggtctacatgttgaatagtacaaaattgaagggagatatcgaagaacttgat
agaaacggaatgacagccctgatgattgtagcacataatgagggaagagatcaagttgca
tctgcaaagttactcgttgaaaaaggagcaaaagttgattatgatggagctgcgagaaaa
gattcagaaaagtataaaggcagaacggcacttcactatgctgcccaagtgagtaatatg
ccaattgtgaagtatttggttggagagaaaggatccaataaggataagcaagatgaagat
ggaaagacgccgattatgttagctgcacaggaaggacgtattgaagttgtgatgtatttg
attcagcaaggggctagtgttgaagcggttgatgctacggatcatacggctcgtcaactc
gctcaagcaaataaccatcacaatattgttgatatttttgatagatgtcgtccagaacga
gaatattcaatggatcttcacatccaacatacccatcaaccacaaccttcaagaaaagta
actcgagctccgaagaaacagacaagtcgaagcaaaaaagagtcagcttccaattctcga
gactcaactcatctgacacctccaccatcggatggatcaacgtcaacaccgtcaccacag
cattttatgaataccactcatactacaccgacgagtttgaactatttgagcccagaatat
caaactgaagctggaagctcagaagcgttccaaccacaatgtggagcatttggaaatggc
gaaatgtggtatacaagagcttcaacatcgtacacccaaatgcagaatgaaccaatgacg
cgatactccgaaccagctcattatttttga

DBGET integrated database retrieval system