KEGG   Caenorhabditis elegans (nematode): CELE_R11A8.5
Entry
CELE_R11A8.5      CDS       T00019                                 

Gene name
pges-2
Definition
(RefSeq) ProstaGlandin E Synthase homolog
  KO
K05309  microsomal prostaglandin-E synthase 2 [EC:5.3.99.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00590  Arachidonic acid metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CELE_R11A8.5 (pges-2)
Enzymes [BR:cel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     CELE_R11A8.5 (pges-2)
SSDB
Motif
Pfam: GST_N_3 Glutaredoxin GST_N GST_N_2 GST_N_4 GST_C_2
Other DBs
NCBI-GeneID: 177925
NCBI-ProteinID: NP_501913
WormBase: WBGene00011239
Ensembl: WBGene00011239
UniProt: Q21925
Position
IV:complement(join(10366512..10366664,10366713..10366827,10366871..10367157,10367207..10367359,10367407..10367505,10367554..10367790))
AA seq 347 aa
MRFFGVRTVQIASLAGFSWGGSKLDDIQTAKLRTCPIQVQQPEKVQNDVLLSRKVINHLD
KSNLKLRLYQYETCPFCCKVRAFLDYHGFSYEVVEVNPVTRSQIKFSTTYKKVPILRSGE
TTMTESTLIISTLATYLQRPDQSLDQIIQMYPAVDSTNEKGKPVLNYPNKFFVMKGKVDG
DANMASAREEREWREWVDNWFIHLISPNVYRNWNESVETFRWFEQVGDWHRTFPAWERVL
AVYVGAAAMFLLSKTLKKKHNINDEREELRKACRDWMAAIGPNRQFLGGDEPNLADLSLY
GAMNSFYGCSAFKEVILEEKIAEWWRKMDALVKNHDGRKALESRSQK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcgtttttttggtgtacggacagtccagattgcttctttggctggattctcgtgggga
ggatcaaagctggacgatatccaaacagcaaaactcagaacatgcccaattcaagttcag
caacccgagaaagtgcagaatgatgtcctcctcagtcgaaaagttattaatcacctggat
aagtcaaacttgaagctccgattgtatcaatacgagacttgcccgttctgttgcaaggtt
cgagccttcttagattatcacggattctcctatgaggttgtagaagtaaatccagtcact
agatcacagatcaagtttagcacaacttataaaaaagttccaattctcaggagtggcgag
acaactatgaccgagtctactttgattatttccacattggcaacatatcttcaaagaccc
gatcagtcactcgaccagataatacaaatgtatccagcagttgattcaacaaacgagaaa
ggaaagccagttctcaactaccctaacaaattcttcgttatgaagggaaaagtagacggg
gacgcaaatatggcttctgccagagaagagcgggaatggagagaatgggtggacaattgg
ttcatccatcttatttctcctaatgtatatcgtaattggaatgagtctgtcgagacattc
cgttggttcgaacaagttggcgactggcatcgtacttttccagcctgggagagagttcta
gcggtatacgtgggtgcagcagcaatgtttttactttcaaaaacattgaagaaaaagcac
aacatcaatgatgaacgagaagaattgagaaaggcttgtcgtgactggatggcagcaatt
ggaccaaatagacagtttttaggaggagatgaaccgaatctagctgatctgtcattatat
ggagctatgaattctttctatggatgctcagcgttcaaagaagttattttagaagaaaaa
attgctgaatggtggcgaaaaatggatgcacttgtcaaaaaccacgatggaagaaaagca
ttggaatcaagaagtcaaaaataa

DBGET integrated database retrieval system