KEGG   Caenorhabditis elegans (nematode): CELE_R13A1.9
Entry
CELE_R13A1.9      CDS       T00019                                 

Gene name
best-16
Definition
(RefSeq) Bestrophin homolog
  KO
K22204  bestrophin, other
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_R13A1.9 (best-16)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_R13A1.9 (best-16)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 3565658
NCBI-ProteinID: NP_001023344
WormBase: WBGene00020046
Ensembl: WBGene00020046
UniProt: Q7YXH3
Position
IV:complement(join(7193520..7193605,7193651..7193724,7193776..7193919,7193968..7194113,7194213..7194293,7194341..7194403,7194460..7194543,7194590..7194667,7194719..7194763,7194806..7194988,7195038..7195131,7195176..7195310,7195504..7195682))
AA seq 463 aa
MTVSYALSVSSARYSAFLKLLQKWKGSVLKAVWAELLVWIGLYTAIALIINLSFSPETKT
AISIEAARLDDQLGILDIKFMLGFFVTIVVDRWKTILQNIGFIETVALSVSTIIRGSDDN
VRLARRSIIRYLVLSQAMVYRDISMRVRRRFPTMKSLMEAGFIFENELHELEQTETGYNK
YWVPINWCNSIVWRMQEQKYIEAPVSTNNVLNNIRDFRTQLENLCKFDWVPIPISYPQIV
FLAVRIHFFFTLFTRQYIPMETEEYLWYRHIPLIPATSFFLYLGWMKVAEALLNPFGEDD
DDFEGNWVIDKNIKTGMQIVDESHAECPILNIDQFSDPKFGPMYPSVLAEHPHILQGSAA
DVVIPDSDKSKMVHVDSKTSVASGASGSNDQRRESSIRRRFRRLSTRLKLGRSISHPKGQ
TVKSPGGESTQSAFSNLEFVTEENEDPRADMRIDMEEEKPNKK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgacagtttcatatgcattgtctgtttcatctgctcgatattcggcgtttttaaaatta
cttcaaaaatggaaaggatcagttttaaaagctgtgtgggctgagcttcttgtatggatt
ggattgtacacagctattgcacttattatcaatttatctttttctccagaaactaagaca
gcaataagtatagaagccgctcgtctagatgatcaactcggaattcttgatataaagttt
atgctcggattttttgttacaattgttgtcgatcgatggaaaactattttacaaaatatt
ggtttcattgaaactgttgccctctcagtttctacaattattcgtggatcagatgacaat
gttcgtttggcacgaagatctattattcgatatttggtattgtcgcaggcaatggtgtac
agagacatttctatgagagttcgtcgacggtttcctaccatgaaaagtttgatggaagca
ggtttcatttttgaaaatgagcttcatgagttggaacagactgagactggatataacaag
tattgggtacctatcaattggtgtaattcaattgtatggcggatgcaagagcaaaaatat
atcgaagcccccgtttctaccaataatgttttgaataatattcgagattttcgaacccaa
ctcgaaaatctgtgtaagttcgactgggttccaattcctatttcttatccacagatcgtt
ttccttgctgttcgaattcatttcttcttcactttgttcacaagacagtacattccaatg
gaaactgaagaatatttgtggtatcgtcatattcccttgattcctgctacatcgtttttc
ctttatctcggctggatgaaagtagctgaagcccttctgaatccgttcggtgaagatgat
gacgattttgagggaaattgggtcattgataaaaacatcaagactggaatgcaaattgta
gatgaaagccatgcagaatgcccaatactgaatattgatcagttttcggaccccaaattt
ggtccaatgtacccaagtgttcttgctgagcatccacatattcttcaaggttctgctgct
gatgttgtgataccagactctgataaatcaaaaatggttcacgtcgatagcaaaaccagt
gttgcatcgggagcctcaggatcaaatgatcagagaagagaatcgtcaattcgaagaaga
ttccgtagattgagtactcgattgaagcttggtagaagtatctcacatccaaaaggacaa
acagtcaaatcaccgggtggagagagtacgcaaagtgctttcagcaatcttgagttcgtt
accgaggaaaatgaagatccgagagcagacatgagaattgatatggaagaagaaaaacca
aataaaaaataa

DBGET integrated database retrieval system