KEGG   Caenorhabditis elegans (nematode): CELE_R13A5.1Help
Entry
CELE_R13A5.1      CDS       T00019                                 

Gene name
cup-5
Definition
(RefSeq) Uncharacterized protein
  KO
K04994  mucolipin 3
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cel04040]
    CELE_R13A5.1 (cup-5)
Ion channels [BR:cel04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   CELE_R13A5.1 (cup-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PKD_channel Ion_trans X8 Orthoreo_P10
Motif
Other DBs
NCBI-GeneID: 176074
NCBI-ProteinID: NP_001022721
WormBase: WBGene00000846
Ensembl: WBGene00000846
UniProt: H2KYK0
Position
III:join(7584181..7584246,7584689..7585141,7585191..7585374,7585419..7585730,7586109..7586380,7586662..7586769,7589429..7589656,7589703..7589804,7590537..7590675,7591223..7591248)
Genome map
AA seq 629 aa AA seqDB search
MSRIFRSQASRSMRLEQIPLESMSRRSTTDRSDFNDNASNASSNASRRPTINFQEIMEDL
PHHERETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSH
VDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRND
SFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLN
LTETEVFQIGQSDDAVRDILATRGITFLPEDALKISTVQFKFRLRTIHYSPTAGDQKPEC
YKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILC
ILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLDFLNLWYVMIVVNDALIIIGT
VAKISIEFQDFDNSLFTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMR
FMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFATFYTINDSNTVI
KVFGTVYIYLFVSLFIYVVLSLFIAIIMDAYEVVKDRYSDGLRAIEKRGCLRDFVESNPP
PSELGSPTTRSAYAPSNLLNLVFNHSPTR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaatattcagaagccaagcttcgagatcgatgcggttagagcaaattcccctc
gaatcgatgtctcgccggagcacaactgatcgttcagacttcaacgataatgcttcgaat
gcttcttcaaatgcttctcgaaggccaacaataaattttcaagaaataatggaagatctt
ccgcaccacgaaagagaaaccggcgaacgtcttcgccgtcatctccaattcttttttatg
aatccaatggagaaatggaaagtcagacatcaactgccctataagttggttctacaagtg
ctcaaaatagttttcgttaccatgcaattaattttattcgcggaaatgcgcatgtctcat
gttgattttctcgaagacaccacaacagttatgagacatcgatttttaaaagaatggaat
gacgacagagatgcattacaatatccaccagctgaaggaagatattcggtttatgatgat
caaggattatccgagcatttgagctttttgattaattcttattattcaattcgcaatgat
tcatttgcttcattttcctatgacgttgtaagtcatccatctggaaatcttggcgctcaa
attagttttgaatctattccacctattgaagttcttatcgatcgaatttccaacgtaaca
gtgaacaataacacttataatttcgacattcgtgaagtgaaagacacgaaacgtctgaat
ctaacagaaacggaagtcttccaaatcggacaatccgatgatgctgttcgagatattctc
gccactcgtggaatcacatttctcccagaagacgcgctcaagatatcgacggtccaattc
aaatttcgactacgaacaattcattattcaccaacagccggagatcagaaaccagaatgc
tataagatatcagtttctatcaaatttgataattcaaggcatacaggacaggttcatgtc
actctatcaactgtggtttcttatgtgaatgtttgtaatggaaggatcatcaaaggtgtt
ggatggtcatttgacacacttttaatcggcggaaccgatattttcgttctcattctttgc
attctatcactgattctctgctgccgagccctcatcaaagcccatctacttcaaatcaaa
acaagcgactattttgagaatgtactcaaaaataagatcaccgttaccgatcaactcgat
tttctgaatttgtggtatgtgatgattgtggtcaacgatgcgcttattatcattggaact
gttgcaaaaatatccatcgagtttcaggatttcgacaattccctcttcacgctaacttcg
attttcctcggaatgggagctttgctggtatatgtcggagttcttcgatattttggattt
ttcagtcaatataatatcctcatgctcacgctcaaacgatcggcacccaatatcatgcgc
ttcatgacgtgtgccattgtactttacgctggtttcttgattgccggatgggttattatt
ggcccgtacagtatgaagttccgtacactggcagaatcatcggaagctctattttcgctt
ctcaacggtgacgatatgttcgccacgttttacactattaatgattccaatacagttatc
aaggtatttgggacagtgtacatctacctattcgtgtcactctttatctatgtagtatta
tcactgttcattgcaattatcatggatgcatatgaagtcgtcaaggatcgctactcagac
ggtcttcgagccatcgaaaaacgtggatgtcttcgcgatttcgtggaatcgaatccaccg
ccgtcggaactcggctcaccgacgactcgatccgcctacgcaccgtctaatctgctcaat
ctggttttcaatcattctccaacccgctga

DBGET integrated database retrieval system