KEGG   Caenorhabditis elegans (nematode): CELE_T01C8.5
Entry
CELE_T01C8.5      CDS       T00019                                 

Symbol
got-1.2
Name
(RefSeq) Aspartate aminotransferase, cytoplasmic
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00220  Arginine biosynthesis
cel00250  Alanine, aspartate and glutamate metabolism
cel00270  Cysteine and methionine metabolism
cel00330  Arginine and proline metabolism
cel00350  Tyrosine metabolism
cel00360  Phenylalanine metabolism
cel00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01210  2-Oxocarboxylic acid metabolism
cel01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CELE_T01C8.5 (got-1.2)
   00270 Cysteine and methionine metabolism
    CELE_T01C8.5 (got-1.2)
   00220 Arginine biosynthesis
    CELE_T01C8.5 (got-1.2)
   00330 Arginine and proline metabolism
    CELE_T01C8.5 (got-1.2)
   00350 Tyrosine metabolism
    CELE_T01C8.5 (got-1.2)
   00360 Phenylalanine metabolism
    CELE_T01C8.5 (got-1.2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CELE_T01C8.5 (got-1.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_T01C8.5 (got-1.2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T01C8.5 (got-1.2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T01C8.5 (got-1.2)
Enzymes [BR:cel01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     CELE_T01C8.5 (got-1.2)
Amino acid related enzymes [BR:cel01007]
 Aminotransferase (transaminase)
  Class I
   CELE_T01C8.5 (got-1.2)
Membrane trafficking [BR:cel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CELE_T01C8.5 (got-1.2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T01C8.5 (got-1.2)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_T01C8.5 (got-1.2)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 181726
NCBI-ProteinID: NP_510709
WormBase: WBGene00020146
Ensembl: WBGene00020146
UniProt: Q22067
Position
X:complement(join(16791525..16791673,16791723..16792031,16792079..16792449,16792715..16793112))
AA seq 408 aa
MSFFDGIPVAPPIEVFHKNKMYLDETAPVKVNLTIGAYRTEEGQPWVLPVVHETEVEIAN
DTSLNHEYLPVLGHEGFRKAATELVLGAESPAIKEERSFGVQCLSGTGALRAGAEFLASV
CNMKTVYVSNPTWGNHKLVFKKAGFTTVADYTFWDYDNKRVHIEKFLSDLESAPEKSVII
LHGCAHNPTGMDPTQEQWKLVAEVIKRKNLFTFFDIAYQGFASGDPAADAWAIRYFVDQG
MEMVVSQSFAKNFGLYNERVGNLTVVVNNPAVIAGFQSQMSLVIRANWSNPPAHGARIVH
KVLTTPARREQWNQSIQAMSSRIKQMRAALLRHLMDLGTPGTWDHIIQQIGMFSYTGLTS
AQVDHLIANHKVFLLRDGRINICGLNTKNVEYVAKAIDETVRAVKSNI
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgtccttctttgacggaatcccagttgctccaccaatcgaggtgttccacaagaacaag
atgtacctcgatgagacggctcccgtcaaagttaacctgacaattggagcctaccgcaca
gaggagggacagccatgggtgcttccagtcgttcatgagactgaagtcgaaatcgccaac
gacacctcgctcaatcacgagtatcttccagttctcggtcacgagggtttccgcaaggct
gccaccgagcttgtcctcggagccgaatcgccagctatcaaggaggaaagatcgtttgga
gtacagtgtctctctggaaccggagctcttcgtgctggagccgagtttcttgcttcagtg
tgtaacatgaagaccgtctacgtgagcaacccaacatggggaaatcacaagcttgtcttc
aagaaggctggtttcaccaccgtcgccgactacaccttctgggactatgataacaaacgt
gtgcacattgagaagttcctctccgatcttgagtcagccccagagaagtctgtcatcatt
cttcacggatgtgctcacaacccaactggaatggacccaactcaggagcaatggaagttg
gttgccgaggtgatcaagagaaagaacctcttcaccttctttgacattgcttaccaagga
ttcgcatctggtgatccagctgcggacgcctgggcgatccgctactttgtagaccaggga
atggagatggttgtgtcccaatcatttgccaagaactttggactttacaacgagcgtgtc
ggaaaccttactgtcgtcgtcaacaatccagctgtcattgccggattccagtctcaaatg
tcgttggttatccgtgccaactggtccaatccaccagcacatggagcaagaattgtgcac
aaggtgctcaccaccccagctcgccgtgaacaatggaaccagtctattcaagcgatgtct
tctcgtatcaagcagatgagagccgccttattgcgccatttgatggatcttggcactcct
ggaacttgggatcacatcattcaacaaattggaatgttcagctacaccggacttacttct
gcccaagtggatcacctgattgccaatcacaaagtattcctgctcagagacggccgcatc
aacatttgtggtcttaacacgaaaaacgtggaatatgtcgccaaggcgattgatgagact
gtgcgtgccgtgaagagcaacatctaa

DBGET integrated database retrieval system