KEGG   Caenorhabditis elegans (nematode): CELE_T01G9.6Help
Entry
CELE_T01G9.6      CDS       T00019                                 

Gene name
kin-10
Definition
(RefSeq) Casein kinase II subunit beta
  KO
K03115  casein kinase II subunit beta
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03008  Ribosome biogenesis in eukaryotes
cel04137  Mitophagy - animal
cel04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CELE_T01G9.6 (kin-10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_T01G9.6 (kin-10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    CELE_T01G9.6 (kin-10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cel03009]
    CELE_T01G9.6 (kin-10)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_T01G9.6 (kin-10)
Ribosome biogenesis [BR:cel03009]
 Eukaryotic Type
  90S particles
   Kinase
    CELE_T01G9.6 (kin-10)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     CELE_T01G9.6 (kin-10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CK_II_beta
Motif
Other DBs
NCBI-GeneID: 172610
NCBI-ProteinID: NP_492255
WormBase: WBGene00002196
Ensembl: WBGene00002196
UniProt: P28548
Position
I:complement(join(8289201..8289351,8289884..8290073,8290241..8290429,8290483..8290639,8290797..8290814))
Genome map
AA seq 234 aa AA seqDB search
MSSSEEVSWITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPDD
IEDNATNTDLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLP
IGLSDVPGEAMVKLYCPRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRPRRPVT
QFVPKLYGFKIHPVAYGGQEGNSGGNTANNVAAAQNNTTPAGQQSGGQFNNYGL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttcggaggaggtatcatggatcacatggttctgtggccttcgtggaaatgag
tttttctgtgaagtcgacgaggaatatattcaggatcggttcaatttgacaggtctcaat
gagcaagtgcccaagtatcgacaggctcttgacatgattcttgacttagaaccagatgac
atagaggataacgcaacgaacactgatcttgttgaacaagccgctgaaatgctttatgga
ctcattcacgctagatatattcttacgaatagaggaatctcacagatggtcgaaaagtgg
cgtgatcatgactttggagtttgcccacgtgtctactgtgaaaatcagccaatgcttcca
attggattgtctgatgttcctggcgaggctatggtgaaattgtactgtccacgttgcaat
gatgttttcgttccacgatcatcacgtcatcaacatactgatggaagctattttggcacc
ggattcccacatatgctcttctttgttcatcctgatctgcgtccacgcagaccagtcact
caattcgttccaaaactctacggtttcaaaattcatcctgttgcttatggaggacaggag
ggaaacagcggcggaaatacggcgaataacgttgccgcagcacaaaacaacacgactcca
gccgggcaacaatctggaggacaattcaataattatggtctctga

DBGET integrated database retrieval system