KEGG   Caenorhabditis elegans (nematode): CELE_T01H3.1Help
Entry
CELE_T01H3.1      CDS       T00019                                 

Gene name
vha-4
Definition
(RefSeq) Vacuolar H ATPase
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
cel04142  Lysosome
cel04145  Phagosome
Module
cel_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CELE_T01H3.1 (vha-4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_T01H3.1 (vha-4)
   04142 Lysosome
    CELE_T01H3.1 (vha-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_C
Motif
Other DBs
NCBI-GeneID: 174272
NCBI-ProteinID: NP_495659
WormBase: WBGene00006913
Ensembl: WBGene00006913
UniProt: G5EDB8
Position
II:complement(join(7878413..7878703,7878839..7878986,7879035..7879167,7879241..7879313))
Genome map
AA seq 214 aa AA seqDB search
MAAGAILKTTATLTVITTLIILGTGLFYMLSGQGHRFDIGWFLTSTSPHMWAGLGIGFSL
SLSVLGAGWGIFTTGSSILGGGVKAPRIRTKNLVSIIFCEAVAIFGIIMAFVFVGKLAEF
RREDLPDTEDGMAILARNLASGYMIFGGGLTVGLSNLVCGLAVGIVGSGAAIADAANPAL
FVKILIIEIFASAIGLFGMIIGIVQTNKASFGNK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggagcaattttaaaaacgactgctaccttgacggtaatcacaaccctgatc
attcttggaacagggttgttttacatgctcagtggacaaggacatcgatttgacattgga
tggttcttgacatcgacatcaccacatatgtgggctggtcttggtatcggattctcgctt
tcgctttccgtcttgggagccggatggggaatcttcacaacgggatcttcaattctcgga
ggaggagttaaggcaccaagaattagaacaaagaatcttgtttctattattttctgcgaa
gctgttgctattttcggtattatcatggctttcgtgttcgtcggaaagctcgctgaattc
cgtcgtgaagatcttcctgatactgaagacggaatggcaatccttgctcgtaacctcgct
tcaggatacatgatctttggaggtggtctcaccgtcggactctccaaccttgtctgtggt
cttgctgtcggaatcgtcggatctggagctgccattgctgatgccgccaatccagctctt
ttcgtcaagattctcattattgaaattttcgcttccgctattggactcttcggaatgatc
atcggaattgttcagactaacaaggcttcattcggaaacaaataa

DBGET integrated database retrieval system