KEGG   Caenorhabditis elegans (nematode): CELE_T02E9.1
Entry
CELE_T02E9.1      CDS       T00019                                 

Gene name
npr-25
Definition
(RefSeq) G_PROTEIN_RECEP_F1_2 domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: 7tm_1 Ogr_Delta
Other DBs
NCBI-GeneID: 179570
NCBI-ProteinID: NP_505883
WormBase: WBGene00011381
Ensembl: WBGene00011381
UniProt: O18014
Position
V:complement(join(11349473..11349902,11350289..11350449,11350569..11350778,11352142..11352322,11352845..11352993))
AA seq 376 aa
MNITNSSIGYPPPPLVGASFAKTAIPYSICFVFGTLGNTAVLSYVFFITRSLKSSVTALG
NTFIYIVALCAVDLLVTVSIPFSLSYMILNNWVFGELVCKIHFMLELSNKMCSTFILTAL
AFDRYMAICHPEIKRIHEMRHTIYITTILATLSLFLISPVVLSARVTSFKSGQYFVSAKN
ERHEVIRQMCIDGMALEWKVWVSAFLIFFAFLLPCTLLTYFYAKIVLRLRRQRRTMLQSR
IPLRRITIYTMAATFFYLSCHIPFWLPQIYNIFSTVLGHKMNPKVMTFTYYSHLLPFISA
AFNWIFYARLNSQFKKGLVLVTERMIRKRTKSMHEKGYSEAAVELTSKFDDVPLMCPHCE
AQLSIRSSSNGKKNSR
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaatatcacaaattcaagcatcgggtacccacctccaccactggtaggtgcatcattt
gcaaaaacagctataccatattcaatatgttttgtttttggaactctcggcaacacggcc
gttctctcctacgttttcttcattacacgatccctaaaatcatctgtaactgcacttggg
aacacatttatttacatcgttgcattatgcgcagtcgatcttcttgtcaccgtttcgatt
ccattctccctatcgtacatgattctcaacaactgggtattcggagagctggtgtgcaag
atccactttatgcttgagctttctaataagatgtgctccacattcattctaaccgcactg
gcatttgatcgttacatggcaatatgtcatccggaaataaaacgaatccatgagatgcgt
cacacgatttatatcacgacaattcttgcaacattgtcactttttctcatatctccagtc
gttttgtctgccagagtgacgagtttcaaaagtggacaatattttgtgagcgcaaagaat
gaacggcacgaagttatccgacaaatgtgtattgacggaatggcattagagtggaaggtt
tgggtgtctgcatttctgatcttctttgcattcttacttccatgcactcttctaacctac
ttttacgcgaagatcgtccttcgtctgaggagacaaagaagaacaatgctccaatctcga
attcccctccgccgcattacaatatacacaatggcagccacgttcttctatctttcgtgt
catattccattttggctcccacagatctacaacattttctcgacagttcttgggcacaaa
atgaatccaaaagtcatgacattcacctattattcacatcttcttccgttcatatcggcg
gcatttaactggatattctatgctcgacttaatagtcaattcaaaaaaggattggttcta
gttacggaaagaatgatcagaaagcgaacaaaatcgatgcatgagaaaggatacagtgag
gcagctgttgagcttacgagcaagttcgatgatgtcccattgatgtgtccacactgtgaa
gctcaactttctattcgttcaagtagtaatggaaagaagaattcaagataa

DBGET integrated database retrieval system