KEGG   Caenorhabditis elegans (nematode): CELE_T02G5.8Help
Entry
CELE_T02G5.8      CDS       T00019                                 

Gene name
kat-1
Definition
(RefSeq) Acetyl-CoA acetyltransferase homolog, mitochondrial
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00071  Fatty acid degradation
cel00072  Synthesis and degradation of ketone bodies
cel00280  Valine, leucine and isoleucine degradation
cel00310  Lysine degradation
cel00380  Tryptophan metabolism
cel00620  Pyruvate metabolism
cel00630  Glyoxylate and dicarboxylate metabolism
cel00640  Propanoate metabolism
cel00650  Butanoate metabolism
cel00900  Terpenoid backbone biosynthesis
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01212  Fatty acid metabolism
Module
cel_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CELE_T02G5.8 (kat-1)
   00630 Glyoxylate and dicarboxylate metabolism
    CELE_T02G5.8 (kat-1)
   00640 Propanoate metabolism
    CELE_T02G5.8 (kat-1)
   00650 Butanoate metabolism
    CELE_T02G5.8 (kat-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CELE_T02G5.8 (kat-1)
   00072 Synthesis and degradation of ketone bodies
    CELE_T02G5.8 (kat-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CELE_T02G5.8 (kat-1)
   00310 Lysine degradation
    CELE_T02G5.8 (kat-1)
   00380 Tryptophan metabolism
    CELE_T02G5.8 (kat-1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CELE_T02G5.8 (kat-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T02G5.8 (kat-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CELE_T02G5.8 (kat-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_T02G5.8 (kat-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 174161
NCBI-ProteinID: NP_495455
WormBase: WBGene00002183
Ensembl: WBGene00002183
UniProt: Q22100
Position
II:join(7073815..7074024,7074127..7074390,7074487..7074639,7074690..7074825,7074875..7075214,7075289..7075409)
Genome map
AA seq 407 aa AA seqDB search
MLSSSGHAIRRGITTSAALSNKHAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALER
GAVKPSSIQEVFLGQVCQANAGQAPARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQ
QIQTGHQDFAIGGGMESMSQVPFYVQRGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGE
KTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEVVPVNVKSKKGVTIVDKDEEFTKV
NFDKFTSLRTVFQKDGTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAAT
HPLDFAVAPTLMFPKILERAGVKQSDVAQWEVNEAFSCVPLAFIKKLGVDPSLVNPHGGA
VSIGHPIGMSGARLITHLVHTLKSGQIGVAAICNGGGGSSGMVIQKL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcatcgtctggacacgcaattcgccgcggaatcaccacatctgctgcactatca
aacaaacatgctttcatcgtcggagccgcccgtacacctattggatcatttcgttcttct
ctctcttcggtaactgctccagagctcgcctcggttgccatcaaagcagcattggagcgt
ggagcagtgaagccgagttcaattcaggaggtgttccttggtcaagtctgtcaagcaaat
gctggtcaagctcccgctcgtcaagcagctcttggagccggactcgatctttcggttgct
gttaccaccgtcaataaagtgtgctcttctgggctgaaagcaatcattcttgctgcccag
caaattcaaaccggtcatcaagattttgccattggcggaggaatggagagcatgtcacaa
gtaccattttatgttcaaagaggagagatcccatatggtggatttcaagtgattgatgga
atcgtcaaagacggactgaccgatgcttatgataaagttcacatgggaaactgcggagag
aagacttcaaaagaaatgggaattacacgtaaagaccaagacgaatatgctatcaacagc
tacaaaaagtcagctaaagcatgggagaatggaaatatcggaccagaagtggtgccagtg
aacgtcaaatcaaagaagggagtcacgattgttgataaagatgaagagttcacaaaagtc
aatttcgacaagttcacctcgctgagaactgttttccagaaagacggaactatcactgct
gctaatgcttcaacattgaacgacggtgcagctgctgtcattgttgcctcacaggaagca
gtttccgagcaaagcttaaagcctctggcccgaattttggcttatggagatgccgccacg
cacccactcgatttcgctgtagcaccaactttgatgttcccaaaaattcttgaaagagca
ggagtgaagcaatcagatgttgctcaatgggaagttaatgaagccttctcatgtgttccc
cttgctttcatcaaaaaactaggagtcgatccatcccttgtgaacccacatggaggagct
gtttcaattggtcaccccatcggaatgtccggagcccgcctcatcactcatcttgtgcac
acactcaaaagtggccaaatcggagttgctgccatttgcaatggaggtggtggctcaagt
ggaatggttatccagaaattatag

DBGET integrated database retrieval system