KEGG   Caenorhabditis elegans (nematode): CELE_T03D8.3Help
Entry
CELE_T03D8.3      CDS       T00019                                 

Gene name
sbt-1
Definition
(RefSeq) Seven B Two (mammalian 7BT prohormone convertase chaperone) homolog
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Secretogranin_V
Motif
Other DBs
NCBI-GeneID: 180366
NCBI-ProteinID: NP_508020
WormBase: WBGene00011392
Ensembl: WBGene00011392
UniProt: Q9XTY3
Position
V:complement(join(20827837..20828068,20828115..20828446,20828777..20828848))
Genome map
AA seq 211 aa AA seqDB search
MIGAVSLVFFTVGVAAIYGLDLENAGDFVLPSGDFIDLISRDSENLPDLSSFGVKHISGG
AGEGEQKLLEEDNFQERQEVKVDNVLPAYCEPPNPCPVGFTKEHGCLEEFENSAEFSRNY
QADQHCICDQEHMFNCAEKEAQDVSESLQKILEENNMHANTIAKKFHDKRSSDEYVPRRK
RSIPSSAHKVNPYLQGEPLRSMQKKNGKHSW
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtgccgtttctttggttttctttactgtcggagttgcagctatctatggatta
gatttggaaaacgctggagactttgttcttccatccggagatttcattgatctcatctca
cgtgactctgaaaatcttccggatctctcctcttttggagtcaagcatatctctggtgga
gctggcgagggagaacagaaacttcttgaggaggacaatttccaagagaggcaagaagtg
aaagtagacaacgttcttcccgcatactgcgagccaccaaatccatgcccagttgggttc
acaaaggaacacggatgcttggaggagtttgaaaacagtgcagagttttctagaaactac
caagcagatcaacactgcatctgcgaccaggagcatatgttcaactgtgccgagaaagaa
gctcaagacgtcagtgagtccctccaaaaaatccttgaagaaaacaacatgcacgctaac
acaatcgcaaagaagttccatgacaagcgaagctccgatgagtatgttccacgtcgcaag
cgttcaatcccaagctcagcacacaaagtcaacccgtaccttcaaggagagccattgaga
tccatgcagaagaagaatggcaaacattcgtggtaa

DBGET integrated database retrieval system