KEGG   Caenorhabditis elegans (nematode): CELE_T03F6.2
Entry
CELE_T03F6.2      CDS       T00019                                 

Gene name
dnj-17
Definition
(RefSeq) J domain-containing protein
  KO
K09506  DnaJ homolog subfamily A member 5
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cel03009]
    CELE_T03F6.2 (dnj-17)
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_T03F6.2 (dnj-17)
Ribosome biogenesis [BR:cel03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CELE_T03F6.2 (dnj-17)
Chaperones and folding catalysts [BR:cel03110]
 Heat shock proteins
  HSP40 / DNAJ
   CELE_T03F6.2 (dnj-17)
SSDB
Motif
Pfam: DnaJ zf-C2H2_jaz zf-C2H2_2 zf-C2H2_4 zf-met zf-C2H2_12 RPT zinc_ribbon_16
Other DBs
NCBI-GeneID: 176761
NCBI-ProteinID: NP_499759
WormBase: WBGene00001035
Ensembl: WBGene00001035
UniProt: O62360
Position
III:complement(join(13390925..13391166,13391223..13391530,13392283..13392453,13392501..13392631,13392686..13392979,13393024..13393335))
AA seq 485 aa
MKCHYEVLEVERDADDDKIKKNYRKLALKWHPDKNPDRIEECTQQFRLLQAAYDVLSDPR
EREFYDRHRESILKGKNTDFEEQSTDLFPYFTASCYQGYENDKNGFFTVYRKVFNILVSE
EYDAYNDSTIVYPEFGDKDTDLEQTVNGFYGFWSSFSTTRSFAWLDHYDITQASNRFESR
QIDQENKKFRDVGKQERNEQIRNLVAFVRKRDPRVKAYREILEQKKLEAHKKQADNRKKQ
IAKNQELANSYLNDKEAEAARLAHLIEVSLQMAEDYDTCSDECDEEGEELPYCVVCSKSF
KTVNAKLNHENSKQHIRQLNELKKHMKEEDSTIFTEAEPKPDETPKGKKNKRKDRKKGNG
IFDVEETEAVEAEIQEAPPVENEQPEEEEKECTPEVVKKEKKKRRADKNQNPSATVEEEA
PKSTEPKSAICDKCREVFDSRTRLFAHLQETGHATLLINKPGEKGQKKAKNKKGQRGNKG
DDEDW
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaaatgccattacgaagtgctcgaagttgaacgcgacgctgatgacgataaaatcaaa
aagaactacagaaaactagcgctcaaatggcatcccgacaaaaatccggatcgcatcgaa
gagtgtactcagcaatttaggcttcttcaagctgcgtacgacgttttgagtgatccacga
gaacgcgaattttacgatagacatagagaaagtattctgaagggaaaaaatacggatttc
gaggaacaatccacggatttgttcccctatttcaccgcttcttgctatcaaggatatgaa
aacgataaaaatggcttcttcactgtctaccggaaagtcttcaatatcctagtttctgag
gaatatgatgcgtacaacgattcaacaatagtctatccagagtttggcgacaaggatacc
gatttggagcaaactgtgaatggtttctacggtttttggagctctttttcgacaactcgc
tcttttgcctggctggatcattatgatatcacacaggcttcaaatcgattcgaatcacgg
caaatcgatcaggaaaataagaagtttagggatgtcggaaagcaggaaaggaacgagcaa
attaggaatctggtcgcttttgttcgaaaacgtgatccacgtgtcaaagcatatagggaa
attttggagcaaaaaaaattggaagcacataagaaacaagctgataatcgaaaaaagcag
atcgccaaaaatcaagagctagccaactcatatctgaacgacaaagaagccgaggcagcc
cgtcttgctcatttgattgaagttagtctacaaatggccgaggattacgatacttgtagt
gatgaatgtgatgaagaaggagaagaacttccatattgtgttgtttgtagcaaatcgttc
aaaactgtaaacgccaagttgaatcatgagaactcgaagcaacacatccgtcagctgaat
gagctgaaaaagcatatgaaagaagaagattccacgattttcaccgaagcagaaccgaaa
cccgacgaaacaccgaaaggaaagaagaataagagaaaggataggaaaaaggggaatgga
atatttgatgtggaagaaacagaagcagtagaagccgagattcaggaagcgccgcccgtg
gaaaatgagcagccggaggaagaggaaaaggaatgtaccccggaagttgttaagaaagag
aaaaagaagagaagagctgataaaaatcaaaacccatcggcgacagtagaggaagaagca
ccgaagtcaactgaaccaaaatctgcaatttgtgataaatgccgtgaggtattcgatagc
cggaccaggttatttgctcatttacaagaaaccggacacgccacgttgctcatcaacaaa
ccaggagaaaaaggacagaagaaggcgaaaaataagaagggacaacgtggaaataagggg
gatgatgaggattggtga

DBGET integrated database retrieval system