KEGG   Caenorhabditis elegans (nematode): CELE_T03F6.3
Entry
CELE_T03F6.3      CDS       T00019                                 

Gene name
T03F6.3
Definition
(RefSeq) Probable glucosamine-6-phosphate isomerase
  KO
K02564  glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00520  Amino sugar and nucleotide sugar metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CELE_T03F6.3 (T03F6.3)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     CELE_T03F6.3 (T03F6.3)
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-GeneID: 176760
NCBI-ProteinID: NP_499758
WormBase: WBGene00011399
Ensembl: WBGene00011399
UniProt: Q9XVJ2
Position
III:join(13389407..13389629,13389683..13389765,13389832..13390026,13390411..13390713)
AA seq 267 aa
MKLIIEENADKVAEFAARYVVTKINEATENGKYLVLGLPTGSTPLGMYKKLIEFYNAGVI
SFEKVKTFNMDEYVDLPRDHTESYHSFMFDNFFRHIDINPANIHILDGNTSDHEKECEEY
ERKIKESGGIDLFVGGIGPDGHIAFNEPGSSLASRTRIKTLNEDTIQANARFFGGDITKV
PTQALTVGVQTVMDAREVMILITGSHKALALHQAIECGISHMCTVSAMQMHRCATFIADE
DATLELKVKTVKYFKGLMNHHRSLVMF
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaaattgattatcgaggagaacgccgataaagtcgccgaattcgctgctcgatatgtc
gttacaaagatcaatgaagcgactgaaaatggaaaatatctcgtcttaggactgccaacc
ggctcaactccactcggaatgtacaagaaactcatcgaattctacaatgccggagttatc
tcctttgaaaaagtgaaaacttttaatatggacgagtatgtcgatcttccacgtgaccat
acagaatcgtatcactccttcatgtttgacaactttttccgacacattgacattaatcca
gctaatattcacattctcgacggaaatacgtctgatcacgagaaggagtgtgaagagtac
gagcgtaaaatcaaagaatctggcggaatcgatttatttgtcggtggaattggtccagat
ggccatattgcgttcaatgagcccggaagttcgctggcaagccgtacacgtatcaagacc
ctcaacgaggatacaattcaggctaacgctcgtttcttcggtggagacatcacaaaagtg
ccaacacaagctctgacagtcggcgtccagactgtaatggatgctcgtgaagtgatgatt
ctcatcacaggatcacacaaagcgctggctcttcatcaggcaatcgaatgcggaatctct
cacatgtgtacggtctctgcgatgcagatgcatcgatgtgcaacgtttattgccgacgaa
gatgccacgttggagttgaaagtgaagacggtcaaatatttcaaaggattaatgaatcat
catcgttcacttgtcatgttttaa

DBGET integrated database retrieval system