KEGG   Caenorhabditis elegans (nematode): CELE_T04D3.2Help
Entry
CELE_T04D3.2      CDS       T00019                                 

Gene name
sdz-30
Definition
(RefSeq) SKN-1 Dependent Zygotic transcript
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytadhesin_P30 TGT
Motif
Other DBs
NCBI-GeneID: 173198
NCBI-ProteinID: NP_493341
WormBase: WBGene00011432
Ensembl: WBGene00011432
UniProt: O02297
Position
I:13307051..13308685
Genome map
AA seq 544 aa AA seqDB search
MYPQYPAQPAPGVRPIMCPRPLPKFAMGNCPVTRTRTIGVQRFGQYYMFNKHPASPKLVP
HKCLQCQARVTEADLYPKYSVVCNKTSTLVIFVHNGITNKIEQYAYSHSTGGFVEVSFPE
LVYNPSLVTHGNLVVVIKGLKNENIVIERDLRGGIRKQSSHLGPFQAIPPVVVRTLMMQE
IEKGIDVTGNPENPDSAVESDYDSEEDDEDEDDEDDLDVDDLNYLDSLPTFKVRICQASQ
KEVVCVINSCNGNYIKYIYNDHTGNFDFYQGTSKFEVTEDSLVAKYSEFHQGLKKYVFHV
HNLESNLMEKYYYQAEFNSLVQTHCNDLIYDPAKITQSHVLAVINRNDLPQPVVEVIVRN
LYGKIRKEIPEMYGFIQTPVTVKTFIVQMEEERRKKTKIIYDKVQLAKKKNKEIKLKKKV
LEEEEKTEKMMENMTLENSEDQSKKDEATVDAEIRTEESDNPFKRIPVIDAQKRLIDAIF
QRQIDCNIEDSEKQRINIDIQRGLKWFQECKEARKRKEAEAAQKTLEQKHRAALLTFRER
HDDQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtaccctcaatacccagctcaaccagctccaggcgtcaggcccatcatgtgcccaaga
ccattgcccaagtttgcaatgggaaattgtcccgtgacaagaacgcgaacaatcggtgtt
caacgatttggtcaatactacatgttcaacaagcatccggcgtcacccaagctggtccca
cacaagtgtcttcagtgtcaagcgagagtcaccgaagcggatctttatcctaagtactcg
gtggtctgtaataagacctcgacgctcgtcatttttgtgcacaatgggatcacgaacaag
atcgagcagtacgcctattctcactcgactggcgggttcgtggaggtcagctttccggaa
ctcgtgtacaacccgagcctcgtcactcatggtaacctggtcgtggttattaagggatta
aagaatgagaatattgtgattgagagagatcttagaggtggaatcagaaagcaatcctca
catcttggaccattccaagcgattccaccggttgttgtacgtactcttatgatgcaggag
atagagaagggtatagatgtgactggaaacccggaaaacccagattctgctgtagaatct
gattatgattccgaagaggacgatgaggatgaagatgatgaggatgatctcgacgtggac
gatctcaactacctagattctctaccaactttcaaagttaggatctgccaagctagtcag
aaagaggttgtatgtgtgatcaacagttgtaatggaaactacatcaagtacatttacaat
gaccataccggaaacttcgacttttaccaaggtacatctaaatttgaagtcactgaggat
agcttggtggccaagtattccgagtttcaccaaggcttgaagaagtacgtttttcatgtt
cataatttggagagcaacctgatggagaaatattattatcaagcggaattcaattccctt
gttcaaactcattgtaatgatctgatttatgatcccgccaagattacccaaagtcatgtt
ctagcagtaatcaatcggaatgatctaccacaaccggttgtagaagtgattgttaggaac
ttgtatggaaaaattcgaaaggagattccagaaatgtatggcttcattcagacaccagtt
actgtgaaaactttcatagttcaaatggaagaggaacggagaaagaagacaaaaatcatc
tatgataaggttcaattggcgaagaagaagaataaggagataaaattgaagaagaaagtt
ctggaagaagaggaaaaaactgagaaaatgatggaaaatatgactctagagaattctgaa
gatcagtctaagaaggatgaagcaacagtggatgctgaaattagaacggaagaaagcgat
aatcctttcaaaagaattccggtaatcgatgctcaaaaacgacttatcgatgcgatattt
caaaggcagatcgattgtaatattgaagacagtgagaagcaacggatcaatattgacatt
cagagaggacttaaatggtttcaagaatgcaaagaagcaaggaaaaggaaagaagctgaa
gcggcacagaagaccttggagcaaaagcatagagcagcactattgaccttcagggaaaga
catgatgatcaataa

DBGET integrated database retrieval system