KEGG   Caenorhabditis elegans (nematode): CELE_T05F1.3Help
Entry
CELE_T05F1.3      CDS       T00019                                 

Gene name
rps-19
Definition
(RefSeq) 40S ribosomal protein S19
  KO
K02966  small subunit ribosomal protein S19e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Module
cel_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_T05F1.3 (rps-19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_T05F1.3 (rps-19)
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    CELE_T05F1.3 (rps-19)
  Archaea
    CELE_T05F1.3 (rps-19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S19e
Motif
Other DBs
NCBI-GeneID: 172805
NCBI-ProteinID: NP_492555
WormBase: WBGene00004488
Ensembl: WBGene00004488
UniProt: O18650
Position
I:complement(join(9625107..9625166,9625368..9625537,9625581..9625791))
Genome map
AA seq 146 aa AA seqDB search
MTRATSIKDVDQHEATKSIAHFLKKSGKVKVPEWSDLVKLGVNKELAPVDPDWFYTRAAS
LARHLYFRPAGIGAFKKVYGGNKRRGVAPNHFQTSAGNCLRKAVQQLEKIKWVEKHPDGK
GRILSKQGRKDLDRIATSLRSSGQQA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagcgacctccatcaaggacgtcgaccagcacgaggctaccaagtccatcgct
cacttcttgaagaagagtggaaaggttaaggttccagagtggtccgatcttgttaagctc
ggagtcaacaaggagcttgccccagtcgatccagattggttctacacccgtgctgccagt
cttgctcgtcacttgtatttccgccccgccggaatcggagccttcaagaaggtctacgga
ggaaacaagagacgtggtgttgcaccaaaccatttccaaacctcagctggaaactgcctc
agaaaggctgttcagcaactcgagaagatcaagtgggttgagaagcacccagacggcaaa
ggaagaattctctccaagcagggacgcaaggatcttgacagaatcgccaccagcctcaga
tcctctggacaacaagcctaa

DBGET integrated database retrieval system