KEGG   Caenorhabditis elegans (nematode): CELE_T05G5.10
Entry
CELE_T05G5.10     CDS       T00019                                 

Symbol
iff-1
Name
(RefSeq) Eukaryotic translation initiation factor 5A-1
  KO
K03263  translation initiation factor 5A
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cel03012]
    CELE_T05G5.10 (iff-1)
Translation factors [BR:cel03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    CELE_T05G5.10 (iff-1)
SSDB
Motif
Pfam: eIF-5a EFP_N
Other DBs
NCBI-GeneID: 176373
NCBI-ProteinID: NP_001255020
WormBase: WBGene00002064
Ensembl: WBGene00002064
UniProt: P34563
Position
III:complement(join(9745908..9745973,9746023..9746160,9746279..9746431,9746476..9746605,9747053..9747153))
AA seq 195 aa
MRLPTKLNRVSKKNRNLGFGGWMARVAAPKTIESMSEDHHDEEQFDSAESGAAATFPKQC
SALRKNEHVMIRGRPCKIVEMSTSKTGKHGHAKVHMVAIDIFTTKKLEDICPSTHNMDVP
VVKRREYILMSIEDGFCSLMDPESCELKDDLKMPEGDLGNTIREALEKDEGSVLVQVVAA
CGEEAILGYKISTKE
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaggcttccaacaaaactaaacagagtttcaaagaaaaatcgtaatcttggcttcgga
gggtggatggcgagagttgctgccccgaagaccatagagagtatgtccgaagatcatcac
gacgaggagcaattcgactctgccgagtccggagctgctgctactttcccgaagcaatgc
tcggctcttcgcaagaacgagcacgtcatgatccgaggaagaccatgcaagatcgtcgag
atgagcacctccaagactggaaagcacggacatgctaaggttcacatggttgccatcgat
attttcaccaccaagaagcttgaggatatctgcccatccacccacaacatggacgtccca
gtcgtcaagagacgcgagtacattctcatgtcgatcgaagacgggttctgctcgctcatg
gatccagaatcttgcgagctcaaagacgatctcaaaatgccagaaggagacttgggaaac
actatccgtgaggctctcgagaaagacgaaggaagcgtcttggttcaagtcgttgctgcc
tgcggagaggaggctattctcggatacaagatttctaccaaggaataa

DBGET integrated database retrieval system