KEGG   Caenorhabditis elegans (nematode): CELE_T10B11.2
Entry
CELE_T10B11.2     CDS       T00019                                 

Gene name
cerk-1
Definition
(RefSeq) Ceramide kinase 1
  KO
K04715  ceramide kinase [EC:2.7.1.138]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CELE_T10B11.2 (cerk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.138  ceramide kinase
     CELE_T10B11.2 (cerk-1)
SSDB
Motif
Pfam: DAGK_cat CERK_C
Other DBs
NCBI-GeneID: 172423
NCBI-ProteinID: NP_491977
WormBase: WBGene00020398
Ensembl: WBGene00020398
UniProt: Q9TZI1
Position
I:join(6931160..6931235,6931362..6931512,6934173..6934272,6934345..6934492,6934538..6934623,6934761..6934886,6935319..6935688,6935736..6935871,6936274..6936380,6936427..6936527,6936579..6936827)
AA seq 549 aa
MPNSKKSKKGGDQQHVTIVPVEPVKGENVDTVAYSSRSRISGESGHLIADVQSPHAKKHR
IIFDRDHNVFEFRLLDGSAKHIIVYRLDELLSTTCYPFKIKNGVPIIPTKPTTSDKTLYF
NFVYKKDKQKWRLKQIPVIFYTTSERDYWHSLIDTTLRRVKNRPKNIIIFINPFGGNGKA
QKIFKDNVDAFFWLTPGLRYKVVLTERANHARDYIVEMPPEQWSAIDGLVSVGGDGLFNE
LLSGALLRTQTDAGRNIDNPSSHLVTPHIRFGIIGAGSANSIVSTVHETNDHATSAVHIA
IGSECNVDVCTVHQHQKLIRISANAISYGWLGDVLRDSEEYRCLGPIRYQWSALRTTIRH
PIYRGMVQFSLSHKENVNPKDQLPPCLEPCPVCMKPQGNDKYDYHWHAEFTHVICCVIPT
VTPFTPYGLAPFTGIGDGTLDLALVPRISRFHNMQFMRKVAMYGGKQLYELDPSLNCYRV
TKWSYQPDADQEDPGVWNLDGEILEQPKDEPLHFKLHPQLISFFGRDAAMVKPTKRSFIK
KRKSSIVYQ
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgccaaattcgaaaaaaagcaaaaaaggaggagatcaacaacatgtcacaattgttcct
gttgaaccagttaaaggtgaaaacgtggacaccgttgcatattcatcgagaagccgaata
agtggagaaagtggtcacttaattgctgatgttcaatctccacatgcaaaaaagcatcga
attatatttgatagagatcataatgtattcgagttcagattacttgatggttcggcaaag
cacataattgtatatcgtcttgatgagcttctctccacaacttgctatccatttaaaatc
aaaaatggagttccgatcattccgacgaaaccaactacatctgacaagacactttatttc
aattttgtgtataagaaggataaacaaaaatggagactcaaacagattccagtcattttc
tatacgactagtgaaagagattattggcattcactgattgatactacattgagaagagtc
aaaaaccgtccgaagaacattattatctttatcaatccgtttggtggaaatggaaaagca
caaaaaattttcaaggataatgttgatgcattcttctggttgactcctggattacggtat
aaagttgttctcactgaaagagccaatcatgctcgtgactatattgtcgaaatgcctccc
gagcagtggagcgctattgatggattggtatctgttggtggagatggattgtttaatgaa
cttctctctggagctcttcttcgtactcaaaccgatgctggccgtaatattgacaatcca
tcatctcatttggtaactccacatataagatttggtattattggagctggttctgccaat
tcaattgtgtcaactgttcatgaaacgaatgatcatgccacatcagctgttcatattgca
attggatctgaatgcaacgtggatgtatgtacagttcatcagcatcaaaagcttattcga
atttcggcaaatgcaatttcgtatggatggttgggagatgttcttagagattctgaagaa
tatagatgtctcggaccaattagatatcagtggagtgctcttcgaacaacaattcgtcat
ccaatttatcgtggaatggtacaattctctttatcacataaagaaaatgttaatccaaag
gatcaacttccaccgtgtctagagccatgcccagtttgtatgaaacctcaaggaaatgat
aaatacgactatcactggcatgctgaatttactcacgtcatttgctgtgttattccaaca
gttactccatttactccatatggacttgctccttttacaggaattggtgacggaacactt
gacttggcactggttcccagaatctctagattccataatatgcaatttatgagaaaagtt
gcaatgtatggtggaaaacagctctacgaacttgatccatctctaaattgttaccgggtg
accaagtggtcctatcagccagatgccgatcaagaagaccctggcgtttggaaccttgat
ggagaaattttggagcaaccaaaagatgagccactgcatttcaagcttcatccacagctt
atctcattcttcggaagagacgcagccatggtaaagccgacaaaaagaagcttcataaaa
aagcgaaaatcttcgatcgtttatcaatga

DBGET integrated database retrieval system