KEGG   Caenorhabditis elegans (nematode): CELE_T10B5.5
Entry
CELE_T10B5.5      CDS       T00019                                 

Gene name
cct-7
Definition
(RefSeq) T-complex protein 1 subunit eta
  KO
K09499  T-complex protein 1 subunit eta
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_T10B5.5 (cct-7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T10B5.5 (cct-7)
Chaperones and folding catalysts [BR:cel03110]
 Heat shock proteins
  HSP60 / Chaperonin
   CELE_T10B5.5 (cct-7)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T10B5.5 (cct-7)
  Exosomal proteins of colorectal cancer cells
   CELE_T10B5.5 (cct-7)
  Exosomal proteins of bladder cancer cells
   CELE_T10B5.5 (cct-7)
SSDB
Motif
Pfam: Cpn60_TCP1 Beta_helix_2
Other DBs
NCBI-GeneID: 178670
NCBI-ProteinID: NP_503522
WormBase: WBGene00020391
Ensembl: WBGene00020391
UniProt: Q9TZS5
Position
V:join(1872252..1872341,1872400..1872921,1873479..1874189,1874890..1875174)
AA seq 535 aa
MMRPPIILLKDGTENKQGKGQIISNINACQVVADSIRTTLGPRGLDKLIVDSKGATTISN
DGATILKLLDIVFPAASTMVDIARSQDAEVGDGTTSVVVLAAEILKQMKPFIEDGVHPQL
LIRAIGKACEKTLKNLADLEIKINGETELREMLVKCAATTLSSKLVSQERLFFANMIVDA
VNTLDAHLPLNMIGIKKVNGGNLHESRLIKGVAFQKAFSYAGFEMQPKKYSNVKVALLNI
ELELKAEKENAEMRLTNVSDFQAVVDAEWNILYDKLQKIHDSGANVVLSKLPIGDVATQW
FADRDMFCAGRIPQDDLDRLMSACGGSVLTTVSQIDDSVLGKCGKFYEQQVGSERYNFFE
DCSKAQACTLLLRGGAEQFIAETERSLHDAIMIVRRAKKNDSIVAGGGAIEMELSRLIRE
HSKGIEGKDQAFWMAYGQAFEIIPRQLCQNAGLDALDVLNKLRHRHAQGEKWAGIDIHRE
AVGDNLVACVWEPSIVKRNAITAATEAACLVLSIDQTVKNVRTPSGGAMPGLPGQ
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgatgcgcccaccaattatcctgctcaaggacggaactgagaacaagcagggaaagggt
cagatcatttccaacatcaacgcttgtcaagttgtcgccgacagtatccgtaccaccttg
ggtccacgtggcctcgacaagctcatcgtcgatagcaagggagccacgacgatctccaac
gatggagccacaattctgaagcttttggatattgtcttcccggccgcctccacaatggtt
gatatcgctcgttctcaagacgctgaagtcggagacggaaccacgtctgtcgtcgttttg
gccgccgaaattctgaagcaaatgaagccattcatcgaggacggtgtccatccacaactt
ctcattcgcgccatcggaaaagcttgcgagaagacgctgaagaacttggctgatttggaa
atcaaaattaatggcgagacggagctccgtgagatgcttgtgaagtgtgctgcaaccacg
ttgagcagcaagctcgtcagtcaagaacggcttttcttcgccaatatgattgtcgatgct
gtgaacacgttggatgctcatcttccattgaacatgatcggaatcaagaaggtcaacgga
ggaaatttgcacgaatcccgtctcatcaaaggagttgccttccaaaaagcgttcagttat
gctggcttcgaaatgcagccaaagaagtactccaatgtcaaagtggctcttcttaacatt
gagctggagctcaaggcagagaaagagaacgctgagatgcgtctgaccaacgtttccgac
ttccaagctgtcgttgacgctgagtggaatattctttacgataagcttcagaagattcac
gattccggcgccaacgtggttctctcgaaacttccaatcggagatgttgctacccaatgg
ttcgccgatcgtgacatgttctgtgctggacgaattccacaggacgatcttgatcgcttg
atgtccgcatgcggaggaagcgttctcaccacagtctctcaaatcgacgactctgtcctc
ggaaagtgcggaaaattctacgagcaacaagtcggaagcgagcgttacaacttcttcgag
gactgctcaaaagctcaggcatgtacgcttcttcttcgcggtggagccgagcagttcatc
gccgagaccgaacgatctcttcacgacgctatcatgattgttcgtcgtgccaagaagaac
gattcgatcgtcgccggaggaggtgccatcgagatggagttgagccgattgattcgtgag
cattcgaagggtattgagggcaaggatcaagctttctggatggcttatggacaggctttc
gagatcatcccacgccagctttgccaaaacgccggactcgatgctctcgacgtgctgaac
aagctgagacatcgtcatgctcaaggcgagaaatgggccggaatcgacatccatcgtgaa
gccgtcggagataatcttgtcgcatgtgtctgggagccgagcatcgtgaagaggaacgcc
atcacagctgccaccgaagccgcgtgcctcgttctttcgatcgatcaaacggtgaagaat
gttcgtacaccatctggaggagcaatgccaggacttcccgggcaataa

DBGET integrated database retrieval system