KEGG   Caenorhabditis elegans (nematode): CELE_T12E12.4
Entry
CELE_T12E12.4     CDS       T00019                                 

Gene name
drp-1
Definition
(RefSeq) Dynamin-Related Protein
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T12E12.4 (drp-1)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_T12E12.4 (drp-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T12E12.4 (drp-1)
   04990 Domain-containing proteins not elsewhere classified [BR:cel04990]
    CELE_T12E12.4 (drp-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     CELE_T12E12.4 (drp-1)
Membrane trafficking [BR:cel04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    CELE_T12E12.4 (drp-1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    CELE_T12E12.4 (drp-1)
   RhoA-dependent endocytosis
    CELE_T12E12.4 (drp-1)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    CELE_T12E12.4 (drp-1)
   Retention of mitochondria
    CELE_T12E12.4 (drp-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T12E12.4 (drp-1)
Domain-containing proteins not elsewhere classified [BR:cel04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   CELE_T12E12.4 (drp-1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 DUF2076
Other DBs
NCBI-GeneID: 177336
NCBI-ProteinID: NP_741403
WormBase: WBGene00001093
Ensembl: WBGene00001093
UniProt: Q8WQC9
Position
IV:join(5538490..5538802,5538853..5539418,5539464..5540213,5540330..5540480,5540531..5540620,5540673..5540767,5540819..5540935,5540985..5541041)
AA seq 712 aa
MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIV
TRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRV
TGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPS
SIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVK
LGIIGVVNRSQQNILDNKLIVDAVKDEQSFMQKKYPTLASRNGTPYLAKRLNMLLMHHIR
NCLPALKARVSIMNAQCQSDLVAFGEPVEDKNRTLLQIITRFATAYTSTIEGTARNIETT
ELCGGARICYIFHDTFGRSLESVNPLENLTQLDILTAIRNATGPRPALFVPEVSFELLVK
RQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLKERLKP
TNELVENLVAIELAYINTKHPEFTEANLVTLLKEELLLDDRHGRSRNRHASTGERAVSAH
GEQQLQPVPGVNGVDLNAVLQQQQQQSQNQRASNGFLGLFGNAAASSKTSPQEKQSANFL
PEVPETQLGRKLTSREQRDVAIIERLIRNYFIIVRKNIQDSVPKAIMALLVNFVRDNLQS
ELVRQLYKPDEMDDLLAETEDMAQRRRDTLETMKALQQASVIISEVRETQVW
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaaatctcattcctgtcgtcaataaactacaggatgttttcgcaacgttaggcagg
aaagaagatcaaattcaacttccacagattgtagtcgtcggatcacagtcggccggaaag
tcttcagtgctcgaaaatctagtcggtcgggattttctgccgcgtggtactggaattgtc
actcgcaggccattgattcttcagttaaatcacgttgctctcgatgatgaatccaaaaga
agacggtcaaatggaacacttctcacagatgattgggcaatgttcgaacatactggctct
aaggttttcacagacttcgatgccgtgcgaaaagaaatcgaagatgaaactgatcgtgta
actggagtgaataaaggaatctctcttcttccaatcagtttgaaaatttattcccacaga
gttgtctccctctccctggtcgatcttcccggcatcacaaagatcccagttggtgatcaa
ccagtcaatattgaagagcaaatccgtgaaatgattcttctctacatttcaaatccttct
tctatcattctggctgtaactccagcgaaccaggatttcgctacttcggagcctatcaag
ttagctagagaagtggacgcaggtggacaaagaactctcgcagttctcacgaaattggat
ttgatggatcaaggaactgatgcgatggacgtattaatggggaaagtgattccagtaaag
ttgggaattattggagtcgttaatcgatctcaacagaatattctcgacaacaaactgatc
gtggatgcagtgaaagatgagcaaagctttatgcaaaagaaatatccaacattagctagc
agaaatggaactccttatttggcaaagagattgaatatgcttctcatgcaccatattcgc
aactgtcttcctgcactgaaagcccgcgtgtctatcatgaacgcccaatgccaatcggat
cttgttgcattcggtgaaccagttgaagataagaacagaacacttcttcaaatcataact
cgattcgcaactgcttatacatcaactatcgaaggaactgcccgcaatattgaaacaact
gagctatgcggaggtgctcgtatatgctacattttccacgataccttcggaagatctttg
gaatctgtcaatccattggaaaacctcacacaattggatattttgactgcgattagaaac
gcgacaggaccaaggccagctcttttcgtaccagaagtctcatttgaattgcttgtcaag
cgacaaattcaacgattggaggagccatcgttgagatgcgttgagctggtacacgaagaa
atgcaacgaatggttcagcattgcggattcactactcaacaggagatgattcgtttccca
agattgtacgataaaatcaatgaggtcgttagtggagttctgaaagagaggctgaagccc
accaatgagcttgtcgagaatcttgtagccattgaacttgcttacattaatacaaaacat
ccagaattcacagaagccaatttggtgacacttttgaaagaggagcttcttctcgacgat
cggcatggtcgcagtagaaatcgacatgcatcaaccggagaaagagcggtcagtgctcat
ggagaacagcagctacaaccggtaccaggagttaatggtgtcgacttgaacgctgttctt
caacaacaacagcagcaatcccagaaccaacgtgcttccaatggattccttggattattc
ggcaacgccgctgccagcagcaagacgtccccacaagaaaagcaatcagcaaattttttg
ccagaagtgccagagacgcaactaggaagaaagttgacaagtcgtgaacaaagagatgtc
gctattatcgaacggcttattcgaaactatttcatcattgttcgtaagaatattcaggat
agtgtgccgaaagctattatggcgttactggtcaattttgttagagacaatttgcaatcg
gagctcgttcgtcagctgtacaaacccgacgagatggacgatttgttggctgaaactgaa
gacatggctcagagaagaagagatactcttgaaactatgaaggccctccaacaagccagc
gtgatcatcagcgaagtgagagaaacacaagtttggtga

DBGET integrated database retrieval system