KEGG   Caenorhabditis elegans (nematode): CELE_T13H5.3
Entry
CELE_T13H5.3      CDS       T00019                                 

Gene name
cht-2
Definition
(RefSeq) CHiTinase
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Glyco_hydro_18 Chitin_bind_1
Other DBs
NCBI-GeneID: 174363
NCBI-ProteinID: NP_495798
WormBase: WBGene00011757
Ensembl: WBGene00011757
UniProt: Q22468
Position
II:join(8520930..8520987,8521287..8521378,8521419..8521526,8521585..8521682,8521724..8522098,8522150..8522219,8522271..8522819,8522861..8523221,8523268..8523437)
AA seq 626 aa
MRFVMWMWLFVVWITVLFGVSNGGILDRSCGRRRVGYITSWGKHPFRDDQAEKLTHLVFA
FFVVDSDGSVKLEGDAAKARLEHVKEVASRHPDLKLLYAVGGWENSQYFSVLTADHSRRS
ILISNFVKVIKEYGFDGVDIDWEYPVTGGAVEGTPADRRNYVNLMRELRNELRDLESETG
KSYLISFAGAAGHWVLKPGYDLQQLMKYCDFVNVMSYDYFGAWASKWGAYTGPPAPLQFA
MPKKFSGRMNVHATMKDYSCQIKATDKINMGVPFYGRFWKNVGDAVDSTDDMWRTATATN
SEGTKFEGGDVQWRDLHEKFDTTKTKFHSGSKTPFIWLSEQKTFVGYENAESLKHKVDYI
VENNIGGVMIWAIDFDDDQGTLLNSAAAESICTTSTKSFNYKCSPVDDKRWWTYDDNEEL
AGMCGKSSPLIDGYYPVCDPDDPGHACCGKYGYCGSGAEFCSCPECIDYGADPNLILKEP
VKPSQKITWYTSDAGEGKRGRCGRDVPPLEGEAPTCNPDDANAHCCSNGGYCGNSKEHCE
CNGCIDFAKQRDFKYKPLEWWTFSENPANVGRCGYNAPRLSTGKIPKCDPDSESYCCSNS
GYCGKGEQYCSCLGCADFKANPAFEY
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgagattcgtgatgtggatgtggctgttcgttgtgtggattactgtactttttggagtg
tccaatggtggaatcctagaccgatcttgtggaagacgaagagttggttatattacatcg
tggggcaaacatccatttagagatgatcaggctgaaaagctgacacacttagttttcgcc
ttcttcgtcgtcgattcagatggaagtgtcaagttggaaggagatgctgcaaaagcaaga
ttggaacatgttaaagaggttgcatctcgtcatccagatctcaagcttttgtacgctgtt
ggaggctgggaaaactctcaatatttttccgttttaactgcagatcactctagaagatca
attttaatctcgaactttgtcaaagttattaaagagtacggttttgacggtgttgatatt
gactgggaatatcccgtaacaggcggtgctgttgagggtactccagctgatcgaaggaat
tatgtaaacttgatgagagaacttcgaaatgagttgagagatttggaatccgaaacagga
aagtcgtatctcatatcgttcgctggagcagcaggacattgggtcttgaaaccaggatac
gatctacaacaattgatgaaatattgtgattttgtgaatgttatgagttatgattatttt
ggagcatgggcttcgaaatggggtgcatacactggacccccagcaccattacagtttgct
atgccgaaaaaattctctggaagaatgaacgtacatgccacgatgaaagactacagttgc
caaataaaagcaactgataagataaatatgggtgtcccattctatggtcgtttctggaag
aatgtgggtgatgctgttgactcaacagatgatatgtggagaactgctacggcaactaat
tcagaaggcacaaaatttgaaggtggagatgttcaatggagagatctgcacgagaaattt
gatactacaaaaaccaagtttcattctggatccaaaaccccattcatttggctttctgaa
caaaaaacctttgttggatatgaaaatgctgaaagtctcaaacataaagttgattatata
gttgaaaataatattggaggagttatgatatgggcaattgactttgatgatgatcaaggt
acccttctgaactctgctgcagctgaatctatttgtaccacatcaacaaagtcattcaac
tacaagtgttctccagtagacgacaaaagatggtggacatatgatgataatgaggaattg
gctggaatgtgtggaaaatcgtctccattgattgatggatattatcccgtttgtgatcca
gatgatccaggtcatgcttgttgtggaaagtatggctattgcggttccggtgcagaattc
tgttcttgtcctgaatgtattgactatggtgcagatccaaatttaattttgaaagaacca
gtgaaaccaagccaaaagatcacatggtacacatcggatgctggagaagggaaacgtgga
cgatgtggtcgagatgttccacctttagaaggagaagcgccaacttgtaatccagatgat
gctaatgctcattgttgtagtaatggaggttactgtggaaattcaaaggaacattgtgaa
tgtaatggatgtattgattttgcaaaacagagagatttcaaatataaaccattagaatgg
tggacattttctgagaatccagccaacgttggtcgttgtggttacaatgctccacgactt
tctactggaaaaattccaaaatgtgatccggattctgaatcctactgttgcagtaatagt
ggctattgcggaaaaggagaacaatattgtagctgtttaggatgtgctgatttcaaggca
aatcctgcatttgagtattaa

DBGET integrated database retrieval system