KEGG   Caenorhabditis elegans (nematode): CELE_T14D7.3
Entry
CELE_T14D7.3      CDS       T00019                                 

Symbol
snb-6
Name
(RefSeq) V-SNARE coiled-coil homology domain-containing protein
  KO
K08514  vesicle-associated membrane protein 5
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    CELE_T14D7.3 (snb-6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T14D7.3 (snb-6)
Membrane trafficking [BR:cel04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    CELE_T14D7.3 (snb-6)
SSDB
Motif
Pfam: Synaptobrevin COG2
Other DBs
NCBI-GeneID: 188497
NCBI-ProteinID: NP_495887
WormBase: WBGene00044062
Ensembl: WBGene00044062
UniProt: Q94057
Position
II:complement(join(8859148..8859249,8859295..8859341,8859419..8859497,8859539..8859619))
AA seq 102 aa
MIHQQLPVSRIGWDDQKIMRTRQELNSVKIIMKENVQKIMERQGKLDDLVERAQKLEEAS
DVYVKCAVKIKREMSWKANAIRNGIIAVSSVSAFAGIAYAFL
NT seq 309 nt   +upstreamnt  +downstreamnt
atgattcatcaacaactaccagtgagtcgtattggttgggacgatcaaaagattatgaga
acaagacaggaattgaattcggtgaaaatcatcatgaaggagaacgtgcaaaaaattatg
gagagacagggaaaacttgacgatctcgttgaaagagctcaaaaactcgaggaagcttca
gatgtttacgtcaagtgtgctgtcaagatcaagcgtgagatgagctggaaagccaatgct
attcgtaatggtatcatcgccgtatcaagtgtgtctgcttttgccggaatcgcatacgca
tttctctga

DBGET integrated database retrieval system