KEGG   Caenorhabditis elegans (nematode): CELE_T14G12.2
Entry
CELE_T14G12.2     CDS       T00019                                 

Symbol
aex-4
Name
(RefSeq) t-SNARE protein aex-4
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: DUF5089 DASH_Duo1 V-SNARE_C
Other DBs
NCBI-GeneID: 188509
NCBI-ProteinID: NP_508641
WormBase: WBGene00006454
Ensembl: WBGene00006454
UniProt: G5EEN8
Position
X:join(3729391..3729413,3729462..3729564,3730184..3730274,3730326..3730443,3730498..3730557,3730629..3730730,3731521..3731665,3731757..3731819)
AA seq 234 aa
MARKTIDSIPEPIALPTEETVQKRIKLKMVDLDAEIAKLNVQSLDSSIQMIRDIDQMNVD
AVQTTAALEDQDEQLDKIEANLSNVIDDLNVVSHNITAMEHYCGCGFFRILRAPFKYFRK
RERDIIKEEVLEKMTSPKLRRKEESNMMMFTNSSKRRESTGDFMKRLTCDAIEDELERNL
MQIDQGLESVKNLAVDMHVQLKLQEPKLNRIEELTETNDFVVEGVNDKVKKLLH
NT seq 705 nt   +upstreamnt  +downstreamnt
atggctagaaaaaccattgattcaattccagagccaattgctcttccaacagaagaaaca
gttcaaaagcgcattaaactgaaaatggtggatttggatgcagaaatagcgaaattgaac
gtacaaagtcttgacagtagtatacagatgatccgagatatcgatcaaatgaatgtagat
gcagtccagacaactgctgctcttgaagatcaagacgaacagcttgacaaaatcgaggcg
aatctcagcaatgtcatcgatgatctgaatgttgtttcacataacataacagcaatggag
cattattgcggatgcggcttctttcgaattctccgcgcgccattcaagtattttcgaaaa
cgagagcgtgacatcataaaggaagaagtattagaaaaaatgacgagcccaaaattgcga
cgtaaagaggaaagtaacatgatgatgttcacgaattccagcaagcgaagggagtctacc
ggggattttatgaaacgtctaacatgtgacgcaatagaagatgagttggaacgaaacttg
atgcagattgatcagggacttgaatctgtcaaaaatttggctgttgatatgcacgtacag
ctaaaactacaagaaccaaaactgaacaggatagaagaattgaccgaaacaaatgatttt
gtcgtggagggagtcaatgataaagtgaaaaaactacttcactga

DBGET integrated database retrieval system