KEGG   Caenorhabditis elegans (nematode): CELE_T19B10.7Help
Entry
CELE_T19B10.7     CDS       T00019                                 

Gene name
ima-1
Definition
(RefSeq) Importin subunit alpha-1
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arm_3 IBB Arm
Motif
Other DBs
NCBI-GeneID: 179555
NCBI-ProteinID: NP_505854
WormBase: WBGene00002072
Ensembl: WBGene00002072
UniProt: Q22560
Position
V:join(11239706..11239763,11239808..11240105,11240155..11241073,11241119..11241291,11241343..11241469)
Genome map
AA seq 524 aa AA seqDB search
MGDEFRPSHEERSKMYKSNVRDQNEMRRKRREDEVQIRKNRRDEKFERNRQITVQRSLSH
EETSELLKSVADGLQSMQETTIHEALTVLHENLNNTVWTIHVLVKVQILHKLSDVYCNRV
ISQTTRLLISRTLLKISGIDEVKYERYSSDDRCIQSLVFNISTYGSSEDILCDTFQSIAC
FIIRSITYRNLALDCAIVSELIDASTINMSIILHRSLMWLVFLFCEKLDRCSPHVDEIAP
LLEIISNGIQSTDAMVQTDAASSCASLAEWPPIYHYMSDLKLCSKLVANLRNDKGNARPK
VKAGINSIIQATGYFTEEMIDAGLLEVLKGFVNVSYMSQEVCFIISNICVEGEQTIDKLI
SSGVLREVARVMEASEYRSRREAAFVICHCCASANQKHLEYVVELGMLSAFTDLLTCMDV
SLVSYILDAIYLLLQFGEMRLLPDNSNPVAIKLEEIGCREKLEFLCESQSVDIHARAYTI
IDRFYVDDDAPLNDDPFAGYQRNNIDDTIEKMIREPIMDQPFSF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgaattcaggccatcgcatgaagagcgttcaaaaatgtataaatcgaatgtg
cgtgatcaaaatgagatgcgaagaaaacgacgtgaagatgaagttcaaatcaggaaaaat
cgcagagacgaaaagttcgaaagaaatcgacaaattaccgtccagcgttctttgagccat
gaggaaacttcggaattattaaaatcagtagcagacggtttacaaagtatgcaggaaact
acaattcatgaagcattgacagttttacacgaaaacttgaacaacacggtgtggactatt
catgtgctcgtcaaagtccaaattcttcataaattatcagatgtctactgtaaccgagtc
ataagccagacgacgcgattgcttatttctcgaacattgctcaaaattagtggaattgac
gaggtgaaatacgaaaggtactcttccgatgacagatgcattcaatcgctggttttcaat
atctcgacatatggttcaagtgaagacattctatgtgatacatttcagtcgatagcatgt
tttatcattcgcagtatcacttaccggaatctggctctcgactgtgcaattgtttcagag
ctaatcgacgcgagcacgataaatatgagcataattcttcatcgatctctcatgtggctt
gtctttctattctgtgagaaactagacagatgcagtccccatgtggacgaaattgcacct
cttcttgaaattatttccaatggaatacagtcaacagacgcgatggttcagacagatgct
gcttcatcatgtgcttcattagcggaatggcctccaatttatcattacatgagtgatctt
aaattatgttccaaactcgtcgcaaatctgagaaacgataaaggaaatgctcgtccaaaa
gtcaaagctggaattaattcaattattcaagcaactggatattttaccgaagaaatgata
gatgctggattgttggaagtactcaaaggatttgttaatgtcagctatatgtcgcaggaa
gtatgctttatcatctccaatatttgcgtcgaaggcgagcaaacaatcgataaattaatt
tcatctggagtgttacgagaagttgctcgagtcatggaagcttccgaatatcgttctcgg
cgagaagctgcgtttgtcatttgccattgttgcgcttcagcaaaccagaaacatctcgaa
tatgttgttgaattgggaatgctctctgcatttacagatttactgacgtgtatggatgtc
tctctcgtttcctatattcttgatgcaatttacttacttcttcaatttggtgagatgcgt
ttattacctgataattcgaatccggttgcaataaaattggaggaaataggatgtcgtgaa
aagctggaattcttatgtgaaagtcaaagtgtagatattcatgctcgagcatataccatt
attgataggttctatgtagacgacgatgctccactaaatgatgatccctttgctggttat
caaaggaacaatattgacgatactattgaaaaaatgatacgtgagccgataatggaccaa
ccattctcattttag

DBGET integrated database retrieval system