KEGG   Caenorhabditis elegans (nematode): CELE_T19D12.10Help
Entry
CELE_T19D12.10    CDS       T00019                                 

Gene name
T19D12.10
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-GeneID: 188611
NCBI-ProteinID: NP_495354
WormBase: WBGene00020584
Ensembl: WBGene00020584
UniProt: O76838
Position
II:complement(join(6655190..6655447,6655660..6655752,6655797..6656048,6656094..6656214,6656265..6656413,6658125..6658232,6658279..6658384,6658433..6658541,6658593..6658696,6658745..6658812))
Genome map
AA seq 455 aa AA seqDB search
MEKLEEKRRTFNDKTRFVVLFLGICSIICNHGAYTTISFTVICMQDVIEDHHSVNQTHWL
ENSADVSFVFTAGAIGAIAGLIPSVPLTTKYGIRNVLAFYSCSSSIATLLMPLAVSFGYF
PVIIARVIQGFGASILFSSIGSISEGWSPIAEISTYIAFLSAGFQLSNIITMPLSGILCE
SSLGWRSIYYLYGGVAFLVTTAFFAFFRDSAQVHRNVSVKELEKISAGKTVTSGRKSVPY
LAVCKNKVILAVWSSALGGNMSLMTLMIYGPTYLNKVLQLDVKDTGFANAIPYIMATAVK
FTAGPLSDKLTRIPDTWKMIFFAAVSQLGMAMGFFVMALTRSKFIAQIAYTGAIVLAGVN
MIGVVKCAQMVSRQYTHFVMAVNSLISWIAILILPMIIGVLCPNHSPEEWAVFYTSGGIW
VIIMNIPFPFLVTTEAADFTKPGVGEKKVKDIESC
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggagaaactcgaagagaaacgacgaactttcaatgataaaactcgatttgtagtgctt
tttctaggaatttgctcaataatttgtaatcacggtgcatatacgacaattagttttaca
gttatttgtatgcaagatgtcattgaagatcatcattctgttaatcaaactcattggctt
gaaaattctgctgatgtttcgtttgtgttcactgccggagcaatcggagctatagcagga
ctgataccgtcagtgccactcactacaaaatatggaataagaaatgttcttgctttctac
agttgttcatcttccattgcaactttattgatgccattagcagtttcttttggttatttt
cctgtgattattgccagagttatacaaggatttggagcatccatcttgttttcttcaatt
ggtagtatttcagaagggtggtccccaatagcagaaattagtacttatattgcattcttg
tctgcgggatttcagctcagcaacattatcacaatgccactttctggaattttatgtgaa
tcttcacttggatggagatcgatttactatctttatggaggagtcgcatttctagttacc
actgcttttttcgcctttttccgagattcagctcaagttcatcgaaatgtgagtgtgaaa
gaattagaaaaaataagtgctggaaagactgtaacttctggaagaaaatcggtaccgtat
ttggctgtctgtaagaataaagtgatattggcagtttggtcatcggctcttgggggtaat
atgtcactgatgactttaatgatttatggaccaacatatctcaataaagtattacaactt
gatgttaaagatacaggatttgcaaatgcaattccttatattatggcaactgcagtgaaa
tttactgcaggtccattgtctgataaactgacacgtattcctgatacatggaaaatgatt
ttctttgctgcagtctctcaactaggaatggcaatgggattctttgtaatggcattgact
cgatccaagttcattgcacaaatcgcctacactggagccattgttcttgccggtgttaac
atgattggtgtagtgaagtgtgcacaaatggtatcccgtcaatatacgcattttgtaatg
gcagtaaactctctaatttcatggattgccattcttattcttccaatgattatcggagta
ttatgtccgaatcattcaccggaagaatgggctgtattttatacttctggcggaatatgg
gttattattatgaatattccatttcccttcttggtaacaactgaagctgcagacttcaca
aaaccaggagttggagagaagaaagttaaagatattgaaagttgttaa

DBGET integrated database retrieval system