KEGG   Caenorhabditis elegans (nematode): CELE_T19E7.3
Entry
CELE_T19E7.3      CDS       T00019                                 

Gene name
bec-1
Definition
(RefSeq) Beclin homolog
  KO
K08334  beclin
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04136  Autophagy - other
cel04137  Mitophagy - animal
cel04140  Autophagy - animal
cel04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_T19E7.3 (bec-1)
   04136 Autophagy - other
    CELE_T19E7.3 (bec-1)
   04137 Mitophagy - animal
    CELE_T19E7.3 (bec-1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_T19E7.3 (bec-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T19E7.3 (bec-1)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_T19E7.3 (bec-1)
Membrane trafficking [BR:cel04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    CELE_T19E7.3 (bec-1)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    CELE_T19E7.3 (bec-1)
SSDB
Motif
Pfam: APG6 APG6_N FapA YabA PilJ HlyD_2 DUF5071 V_ATPase_I NPV_P10 Macoilin FUSC Seryl_tRNA_N
Other DBs
NCBI-GeneID: 177345
NCBI-ProteinID: NP_500844
WormBase: WBGene00000247
Ensembl: WBGene00000247
UniProt: Q22592
Position
IV:complement(join(5661340..5661525,5662137..5662346,5662541..5662697,5662744..5662818,5663365..5663666,5663713..5663811,5664319..5664417))
AA seq 375 aa
MTTQRSHICLNCQHPLRLDFTQRRPDSADSEKKSETVITEALTGHSRNLMKLISDAQFPS
DAPVCNDCSDALRNEMDAQVATLDDEIKTYQTYINYLKENHPTTSIPDLKAKLQNVSDEE
KELEQQLKKLLAEEEQLDLDLQTKRRTAEAASEKSGELWKKYRDNLRQVFEDQDELHSLE
AERQYAEVQHRKLTDTNVLDLCFHIWVDGIVGEINGFRLGYLKDAPVEFTEINAALGQIV
LLLEILLERIGVQHHELMPVAMGSHSYIKLRRNGIDMETYALYGQGTPLSGSSGIDPGIR
RFLQLLEFLLKELKDRNKNFKPPYQIHADSLVDNGVKYNAVMTLNTDVRWTRAMALMLTD
LKAACAQCDALRSPI
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgacgacccaacgaagccatatttgtctaaactgtcagcatccgttgaggttggatttc
acacaaagaaggccagattcagcggattccgagaaaaaaagcgaaacagttatcacagaa
gctctgactggacattctcgaaacctcatgaagctcatctcggatgctcaattcccatct
gatgctccagtttgtaatgattgctctgacgctcttcgaaatgaaatggatgctcaagtg
gcgacactcgatgatgaaatcaaaacctatcagacttatataaattatttgaaagaaaac
catccgacaacgtcgattccggatttaaaagctaaactgcaaaatgtttccgatgaggag
aaggagctggagcaacagttgaagaaattgttggctgaggaagagcaattggatttggat
cttcagacaaagagaaggactgcagaagcggcgtcagaaaagtctggggaattgtggaaa
aaatacagagataatttaagacaagtattcgaagatcaggacgagcttcattcgctggaa
gccgaacgtcaatatgcagaagttcagcatagaaaactaacagacacaaatgttctcgac
ttgtgcttccacatttgggttgatggaattgttggtgaaatcaatggatttcggttggga
tatttaaaagatgctccagtagaatttacagagatcaatgcagctctaggacaaattgtt
ttgttattagagatcctgttggagcgtatcggcgtacaacatcacgaactgatgcccgtc
gccatgggtagtcactcgtacattaagcttcgtcgtaatggcatcgacatggaaacgtac
gcattgtatggacaaggaactccactatcaggatcatctggaattgatcctggaattcgt
cgattcttgcagttgctcgagtttttgttgaaagagctcaaggatcgaaacaaaaatttc
aaaccaccatatcaaattcatgctgattcactggttgacaatggtgtcaaatacaatgca
gttatgacactcaacacagatgttcgatggactcgtgcaatggctctaatgctcacagat
ctcaaagctgcgtgtgctcaatgcgatgctctcagatcgcctatttag

DBGET integrated database retrieval system