KEGG   Caenorhabditis elegans (nematode): CELE_T20G5.2
Entry
CELE_T20G5.2      CDS       T00019                                 

Gene name
cts-1
Definition
(RefSeq) Probable citrate synthase, mitochondrial
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00020  Citrate cycle (TCA cycle)
cel00630  Glyoxylate and dicarboxylate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01210  2-Oxocarboxylic acid metabolism
cel01230  Biosynthesis of amino acids
Module
cel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cel_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
cel_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CELE_T20G5.2 (cts-1)
   00630 Glyoxylate and dicarboxylate metabolism
    CELE_T20G5.2 (cts-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     CELE_T20G5.2 (cts-1)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-GeneID: 176437
NCBI-ProteinID: NP_499264
WormBase: WBGene00000833
Ensembl: WBGene00000833
UniProt: P34575
Position
III:complement(join(10215056..10215535,10215585..10215905,10215967..10216365,10216411..10216617))
AA seq 468 aa
MSLSGMAIRRLITKGVIPVCQVAPLSTSAEGSTNLKEVLSKKIPAHNAKVKSFRTEHGST
VVQNVNIDMIYGGMRSMKGMVTETSVLDPEEGIRFRGYSIPECQKLLPKAKGGEEPLPEA
IWWLLCTGDVPSEAQTAAITKEWNARADLPTHVVRMLDNFPDNLHPMAQFIAAIAALNNE
SKFAGAYARGVAKASYWEYAYEDSMDLLAKLPTVAAIIYRNLYRDGSAVSVIDPKKDWSA
NFSSMLGYDDPLFAELMRLYLVIHSDHEGGNVSAHTSHLVGSALSDPYLSFSAAMAGLAG
PLHGLANQEVLVFLNKIVGEIGFNYTEEQLKEWVWKHLKSGQVVPGYGHAVLRKTDPRYE
CQREFALKHLPNDDLFKLVSTLYKITPGILLEQGKAKNPWPNVDSHSGVLLQYFGMTEMS
FYTVLFGVSRALGCLSQLIWARGMGLPLERPKSHSTDGLIKLALAAKK
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtcgctctctggaatggctattcgcagacttatcaccaagggagtcatccctgtgtgt
caagtcgctccactttcaacatctgctgaaggatccaccaatttgaaggaggttctttcc
aagaagatcccagcccacaacgctaaagtgaagtcattccgcacagagcacggtagcacc
gtcgttcaaaatgtgaacattgacatgatctacggaggcatgagaagcatgaagggaatg
gtcaccgaaacctcagttcttgacccagaggagggaatcagattccgtggatactctatc
ccagaatgccaaaagcttcttccaaaagcaaagggaggagaagagccgcttccagaagcc
atttggtggcttttgtgtacaggagatgttccatccgaggcccagactgccgctatcaca
aaagaatggaacgcccgtgccgatcttccaacccacgttgtccgaatgctcgacaacttc
ccagataacctccatccaatggctcaattcatcgccgctatcgctgctttgaacaatgaa
agcaaattcgccggagcttatgctcgtggagtcgccaaggcctcctactgggagtacgct
tatgaggactcaatggatcttctcgctaaattgccaactgttgccgctatcatctatcgc
aacctgtaccgtgatggatctgcagtcagtgtcatcgatccaaagaaagattggtccgcc
aacttctcttctatgcttggatatgatgatccacttttcgctgagcttatgagactctac
cttgttattcactctgatcacgaaggaggaaatgtatccgctcacacttcccatcttgta
ggatctgctctttctgatccatacctttccttctccgccgccatggctggacttgctgga
ccactccacggattggctaaccaagaggttctcgttttcttgaacaagattgttggagaa
atcggttttaactacaccgaggaacaacttaaggaatgggtatggaagcacttgaagagc
ggccaagttgtaccaggatatggacatgccgtacttagaaaaaccgatccaagatacgag
tgccaacgtgaattcgcccttaaacatttgccaaacgatgatcttttcaagctggtctcg
actctttacaagatcactccaggaattcttctcgaacaaggaaaagccaagaacccatgg
ccaaacgtggactcccactccggtgtccttcttcaatactttggaatgaccgagatgtcc
ttctacactgttcttttcggagtttctagagctctcggatgtctctcgcaattgatctgg
gccagaggtatgggacttccactcgaacgtccaaagtcacactccaccgatggacttatc
aagcttgctctcgccgccaagaaataa

DBGET integrated database retrieval system