KEGG   Caenorhabditis elegans (nematode): CELE_T20H4.3
Entry
CELE_T20H4.3      CDS       T00019                                 

Symbol
pars-1
Name
(RefSeq) Prolyl Amino-acyl tRNA Synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_T20H4.3 (pars-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_T20H4.3 (pars-1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_T20H4.3 (pars-1)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     CELE_T20H4.3 (pars-1)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CELE_T20H4.3 (pars-1)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CELE_T20H4.3 (pars-1)
 Prokaryotic type
    CELE_T20H4.3 (pars-1)
SSDB
Motif
Pfam: ProRS-C_1 HGTP_anticodon tRNA-synt_2b WHEP-TRS AATF-Che1
Other DBs
NCBI-GeneID: 176024
NCBI-ProteinID: NP_001370820
WormBase: WBGene00004189
Ensembl: WBGene00004189
Position
III:join(7239038..7239124,7239235..7239825,7239944..7240515,7240562..7240768,7240813..7241101)
AA seq 581 aa
MSTKEEITKEIEEQGAEVRRVKGDKNSTEEAKKEAIDKLLALKLTYKEVTGQEYAAPNAR
QSKPKKEEKPKQQPKQQEKKQDGKKQTLLGVGTKKDDNYSEWYSEVITKAEMIEYYDVSG
CYVLRPWSFAVWESIQEWFDSGIKKLGVKNCYFPMFVSNAALEREKTHIADFAPEVAWVT
RAGNSEMAEPIAIRPTSETVMYPSYKKWVQSHRDLPIKLNQWCNVVRWEFKHPTPFLRTR
EFLWQEGHTAFANPADAEKEVFQILDLYAGVYTDLLAIPVVKGRKSEKEKFAGGDFTTTV
EAYVACNGRGIQGATSHHLGQNFSKMFDISYEDPAKEGERAFAWQNSWGLSTRTIGAMVM
IHGDDKGLVLPPRVAAVQVIVVPVGFKTENKQSLFDAVDKVTKDLVADGVKAEHDLRENY
NAGWKFNHWELKGVPIRFEVGPNDLAKNQVTAVIRHNGEKKQLSLEGLSKTVKSLLDEIH
TAMYNKVLAQRDSHLKSTTCIEEFKKLLDEKCIILSPFCGRPDCEEEIKKASTREDGEGA
QMGAKTLCIPLDQPKQELPSKCLFPSCTYNAKAFALFGRSY
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgtcgacgaaagaagaaattacaaaagagatcgaggagcaaggagccgaagtccgccgt
gtgaaaggtgacaagaactccacagaggaagcaaaaaaagaagcaatcgacaagcttctt
gctctgaagcttacttacaaggaggttaccggacaagagtacgcagctccaaatgctcgt
caatccaaaccaaagaaggaagagaaaccaaaacaacagccaaagcaacaagaaaagaaa
caagatggaaagaagcagacattgttaggagttggaaccaagaaagatgataactattcg
gaatggtacagtgaagttatcactaaggcagaaatgatcgaatactatgatgtatctggt
tgctatgttcttagaccatggtcatttgcagtttgggaatctattcaagaatggtttgat
tctggaattaagaaattaggagtgaagaactgctacttcccaatgttcgtatcaaatgct
gccctcgaacgcgaaaagactcatattgctgattttgccccagaagttgcttgggttact
cgtgctggaaactctgaaatggccgaaccaatcgctattcgcccaacttcagagacagtt
atgtacccatcttacaagaaatgggttcaatctcatcgcgatcttccaatcaagttgaac
caatggtgcaatgttgttcgatgggagttcaagcatccaacaccattccttcgtactcgt
gaatttctctggcaagagggacatacggcttttgccaacccagcagacgctgaaaaagag
gttttccaaatccttgatctctacgcaggagtctacactgatttgctcgctatcccagtt
gtgaagggacgaaagagtgagaaggaaaagtttgctggaggagattttacgacgacagtc
gaagcatacgtggcatgcaatggtagaggaatccaaggagcaacttctcaccatctcgga
caaaatttctccaagatgtttgatatttcgtacgaggatccagcgaaggaaggagaacga
gcattcgcttggcaaaattcgtggggtctttccactcgtaccattggtgcaatggtaatg
attcacggagatgacaagggattagtacttccaccaagagttgccgctgttcaagttatt
gttgttccagttggattcaagactgagaacaagcaatcgcttttcgatgctgttgataag
gttaccaaggatttggtcgcggatggagtaaaggctgagcacgatttgagagaaaactac
aatgctggctggaagttcaatcattgggaattgaaaggagtcccaatccgttttgaggtc
ggaccaaatgatttggcaaagaaccaggtaaccgctgtaatccgtcacaacggagagaag
aaacaactttccctggaaggactgtctaaaactgtcaaatctcttcttgatgaaattcat
actgctatgtacaataaggtactcgctcaacgtgactctcacctgaagagcaccacgtgc
atcgaagaattcaagaagcttcttgacgagaagtgcattatactgtccccattctgtggt
cgtccagactgtgaagaggaaatcaagaaggcatcaacaagagaagacggagaaggcgca
cagatgggagccaagacgttatgtattccattggatcaaccaaaacaagaacttccatca
aaatgtcttttcccatcatgcacatacaatgccaaggctttcgctctgtttggaagaagt
tattaa

DBGET integrated database retrieval system