KEGG   Caenorhabditis elegans (nematode): CELE_T21B10.7
Entry
CELE_T21B10.7     CDS       T00019                                 

Gene name
cct-2
Definition
(RefSeq) T-complex protein 1 subunit beta
  KO
K09494  T-complex protein 1 subunit beta
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_T21B10.7 (cct-2)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_T21B10.7 (cct-2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T21B10.7 (cct-2)
Chaperones and folding catalysts [BR:cel03110]
 Heat shock proteins
  HSP60 / Chaperonin
   CELE_T21B10.7 (cct-2)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    CELE_T21B10.7 (cct-2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T21B10.7 (cct-2)
  Exosomal proteins of colorectal cancer cells
   CELE_T21B10.7 (cct-2)
  Exosomal proteins of bladder cancer cells
   CELE_T21B10.7 (cct-2)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-GeneID: 174421
NCBI-ProteinID: NP_741031
WormBase: WBGene00000378
Ensembl: WBGene00000378
UniProt: P47207
Position
II:join(8927745..8927873,8927919..8928036,8928095..8929264,8929311..8929483)
AA seq 529 aa
MLPVQILKDNAQEERGESARLSSFVGAIAIGDLVKSTLGPKGMDKILISGNPESAGGIKV
TNDGATILKSIGVDNPAAKVLVDMSMTQDHEVGDGTTSVTVLAAELLKEAEKLVNQRIHP
QTIISGYRRALGIAQESLKKSSIESGDNIRDDLLKIARTTLGSKILSQHKEHFAQLAVDA
VLRLKGSGNLDAIQIIKKLGGSMNESYLDEGFLLEKLPGMFQPRRVEKAKILIANTPMDT
DKVKVFGSRVRVDGVAKVAELEAAEKLKMKEKVDKILAHNCNVFINRQLIYNYPEQLFAD
AKVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGEDRLLRFSGVK
LGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEAQ
KVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEVA
DVTKLGVIESYNVKLCMVSSAAEATEQILRVDDIIKAAPRARAQDNRPC
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgcttccagtccaaattttaaaggacaatgctcaagaggaacgaggagagagcgctcgt
ctcagctcattcgtgggtgcaatcgccatcggagatcttgtcaagtctactcttggacca
aagggaatggacaaaattctcatcagtggaaacccagaaagcgcaggaggaatcaaagtt
accaacgatggagcaacgatcctgaagtcaatcggtgttgacaatccagctgctaaggtt
cttgttgatatgtcaatgacacaggatcacgaagttggagatggtactacttcagtaact
gtcctggccgcagagctcctcaaagaagccgagaaacttgtcaatcaacgtattcatcca
cagacgatcatttctggatatagacgtgctctcgggattgctcaagaatccttgaaaaag
tccagcattgaatccggagataatattcgtgatgatcttttgaagattgcccgtactact
cttggatctaagattctcagtcaacacaaagagcactttgctcaactcgccgttgatgca
gttttgagactcaagggatctggaaatttggatgccattcaaattatcaagaagctcgga
ggatccatgaatgaatcttatctcgacgagggtttccttctcgaaaaactccctggaatg
ttccaaccaagaagagttgagaaagcaaagattctcattgccaacacaccaatggacact
gacaaagtgaaagttttcggatcaagagtgagagtagatggtgttgccaaggttgctgaa
ctcgaagctgctgagaaattgaagatgaaagaaaaagttgacaaaattctggcccataac
tgtaatgtcttcatcaaccgtcagttgatctacaactacccagagcaactttttgccgat
gctaaggttatggctattgaacacgccgattttgaaggaatcgagaggcttgctcttgtt
ctcggaggagaaattgtttccacatttgattcaccacaaactgctcaattcggatcttgt
gatctgattgaagagattatgattggagaagatagacttcttcggttctcgggagtcaaa
ttgggtgaagcttgctcagtcgttcttcgtggagcaactcagcagattcttgatgagtcc
gaaagatccctccatgatgccctttgtgttctcgttactcacgtgaaagaatcaaagact
gttgccggagctggagcgagcgaaattttgatgagttcagccatcgccgtcgaagctcaa
aaggttgcgggtaaggaagcccttgccgttgaagccttcggaagagcccttgctcaattg
ccaaccatcatttgcgacaatgctggacttgactcggctgaacttgtcacaagactccgt
gcagagcacgccaatggacgtcacaatatgggaatcgacatcgagaaaggagaggttgct
gatgttacgaaattgggcgttattgagtcttacaatgtgaagttgtgcatggtttcttcc
gccgctgaagccacggaacaaattcttcgcgtcgacgatatcatcaaggcagctccacgt
gcccgtgctcaagataaccgaccatgctaa

DBGET integrated database retrieval system