KEGG   Caenorhabditis elegans (nematode): CELE_T22B11.5
Entry
CELE_T22B11.5     CDS       T00019                                 

Gene name
ogdh-1
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00020  Citrate cycle (TCA cycle)
cel01100  Metabolic pathways
cel01200  Carbon metabolism
Module
cel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CELE_T22B11.5 (ogdh-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CELE_T22B11.5 (ogdh-1)
SSDB
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N RepB
Other DBs
NCBI-GeneID: 177235
NCBI-ProteinID: NP_500617
WormBase: WBGene00020679
Ensembl: WBGene00020679
UniProt: O61199
Position
IV:complement(join(4697322..4697531,4698347..4698793,4699445..4699783,4700296..4700439,4700609..4701910,4702545..4702836,4703270..4703517,4703877..4703984))
AA seq 1029 aa
MHRASLICRLASPSRINAIRNASSGKSHISASTLVQHRNQSVAAAVKHEPFLNGSSSIYI
EQMYEAWLQDPSSVHTSWDAYFRNVEAGAGPGQAFQAPPATAYAGALGVSPAAAQVTTSS
APATRLDTNASVQSISDHLKIQLLIRSYQTRGHNIADLDPLGINSADLDDTIPPELELSF
YGLGERDLDREFLLPPTTFISEKKSLTLREILQRLKDIYCTSTGVEYMHLNNLEQQDWIR
RRFEAPRVTELSHDQKKVLFKRLIRSTKFEEFLAKKWPSEKRFGLEGCEVLIPAMKQVID
SSSTLGVDSFVIGMPHRGRLNVLANVCRQPLATILSQFSTLEPADEGSGDVKYHLGVCIE
RLNRQSQKNVKIAVVANPSHLEAVDPVVMGKVRAEAFYAGDEKCDRTMAILLHGDAAFAG
QGVVLETFNLDDLPSYTTHGAIHIVVNNQIGFTTDPRSSRSSPYCTDVGRVVGCPIFHVN
VDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPLMYQRIKQTKTA
LEKYQEKILNEGVANEQYVKEELTKYGSILEDAYENAQKVTYVRNRDWLDSPWDDFFKKR
DPLKLPSTGIEQENIEQIIGKFSQYPEGFNLHRGLERTLKGRQQMLKDNSLDWACGEALA
FGSLLKEGIHVRLSGQDVQRGTFSHRHHVLHDQKVDQKIYNPLNDLSEGQGEYTVCNSSL
SEYAVLGFELGYSMVDPNSLVIWEAQFGDFSNTAQCIIDQFISSGQSKWIRQSGLVMLLP
HGYEGMGPEHSSARPERFLQMCNEDDEIDLEKIAFEGTFEAQQLHDTNWIVANCTTPANI
YHLLRRQVTMPFRKPAVVFSPKSLLRHPMARSPVEDFQSGSNFQRVIPETGAPSQNPPDV
KRVVFCTGKVYYDMVAARKHVGKENDVALVRVEQLSPFPYDLVQQECRKYQGAEILWAQE
EHKNMGAWSFVQPRINSLLSIDGRATKYAGRLPSSSPATGNKFTHMQEQKEMMSKVFGVP
KSKLEGFKA
NT seq 3090 nt   +upstreamnt  +downstreamnt
atgcatcgggcgagtcttatatgtcgtcttgcgtcccccagtcgcatcaatgccatcaga
aatgcttcatccggaaagagccacatttctgcttcgacacttgttcagcaccgcaatcag
tcagtggccgccgccgtcaagcatgaaccattcctaaatggatcctcatccatctacatt
gagcaaatgtacgaagcttggcttcaggatccatcatcagtacacacttcatgggatgcg
tacttccgcaatgtcgaggccggagccggaccaggacaagcttttcaggctccaccagca
actgcctacgctggagctcttggagtttcaccagcagctgctcaagtcacgacctcatct
gccccggccactcgcctcgatacgaatgcatctgttcaatcgatctcggatcacttgaaa
atccagctcctcatccgcagttatcagactcgtggtcacaatatcgcagatctcgatcca
ctcggaataaacagtgccgatttggatgacacgattccaccggagcttgaactctcgttc
tacggacttggagaacgtgatttggaccgagaattccttcttccgcccaccacttttatc
agcgaaaagaagagcttgacgttgagagaaattcttcagagacttaaggatatctattgc
accagcaccggagtcgaatatatgcatttgaacaatctcgagcaacaagattggatccgc
cgacgattcgaagctccacgtgtcaccgagctctctcacgatcagaagaaggtgctgttc
aaacgtctgatccggtctacaaagttcgaagagttcctcgccaaaaaatggccaagtgag
aagagattcggtcttgaggggtgcgaagttctaattccggcaatgaagcaagtcatcgac
tcatcttcgacacttggagtcgactcattcgtcattggaatgccacatcgtggaaggctc
aatgtgcttgccaacgtttgccgtcagccactggccacgattctgtcgcaattctcgact
ctcgagcctgctgatgaaggatccggagatgttaagtaccatttgggagtctgcatcgaa
cgattgaacagacaatcacagaagaacgttaaaatcgccgtcgtcgctaatccatctcac
ttggaagctgtcgatccagttgtgatgggaaaggtccgagctgaagctttctatgctgga
gatgagaagtgcgatcggacgatggctatccttcttcacggagatgctgcgttcgccggt
caaggtgttgtgctcgagacgttcaatttggatgatctgccgagttacacgactcacgga
gccatccacatcgttgtgaacaatcaaatcggattcactaccgatccaagatcttctcgc
tcgtctccatattgtacagatgttggtcgtgtcgtcggatgcccgatcttccacgtgaac
gtcgacgatccggaggctgtaatgcacgtgtgcaatgtcgccgccgattggaggaagact
ttcaagaaggacgttatcgtggatcttgtttgttaccggcgtcacggacacaatgagctc
gacgagccgatgttcactcaaccactcatgtaccaacgaatcaagcaaacgaagacagca
ctggaaaagtatcaggagaagattctcaacgaaggagttgcaaatgagcaatatgttaag
gaagaactcacaaagtacgggtcgattctcgaggatgcttatgagaatgcgcagaaggtg
acatatgttcgtaacagagattggctcgattctccatgggatgatttcttcaagaagcgt
gatccactcaagctaccatcaaccggaatcgaacaggagaacattgaacagattattgga
aaattctcgcagtatccagaaggttttaatcttcatcgtggtttggagagaacactgaag
gggcggcagcaaatgctcaaggataactcgcttgattgggcttgcggagaggctctcgcg
ttcggatcacttttgaaagaaggaattcacgtacgattgagtggacaagatgttcagaga
ggaacattctcacatcgacatcatgttcttcacgatcaaaaagttgatcagaagatctac
aacccactgaatgatctatctgaaggacaaggagaatacacagtctgcaattcatccctc
tcagagtacgctgttcttggattcgaactcggttattcgatggtcgatccgaactctctt
gtcatttgggaagctcaattcggagatttctccaacacagctcaatgcatcattgatcaa
ttcatctcgtcaggacagtcgaaatggattcgtcaatctggattggtgatgcttctgcct
catggatacgaaggaatgggaccagaacactcgtcggctcgaccggaaagattcttgcaa
atgtgcaatgaagacgatgagattgatcttgagaaaatcgcgttcgaaggaacatttgaa
gctcaacaactgcacgataccaattggatcgttgccaactgcacaacaccagccaacatc
tatcatcttctccgccgtcaagtaacaatgccattccgtaaaccggcagtcgtcttctca
ccaaaatctcttctccgtcacccgatggctcgttctccagtcgaagacttccaatctgga
tccaatttccaaagagttattccagaaactggtgctccatctcagaatccaccagacgtg
aagcgagttgtcttctgtactggaaaagtgtactacgatatggtcgccgcccgtaagcac
gttggaaaggagaatgatgttgcactagtcagagttgagcagctctcaccgttcccatat
gatttggtgcaacaagagtgcagaaagtatcaaggagccgagattttgtgggctcaagag
gagcacaagaacatgggagcctggtcattcgtgcaaccacgcatcaactcacttctctcg
attgacggtcgcgccacgaaatacgctggacgtcttccatcctcatcaccagctactgga
aacaaattcactcacatgcaagaacaaaaggagatgatgagcaaagtgtttggagttcca
aaatcgaaattggaaggattcaaggcctaa

DBGET integrated database retrieval system