KEGG   Caenorhabditis elegans (nematode): CELE_T22C1.10Help
Entry
CELE_T22C1.10     CDS       T00019                                 

Gene name
rbg-2
Definition
(RefSeq) Rab3 GTPase-activating protein regulatory subunit
  KO
K19937  Rab3 GTPase-activating protein non-catalytic subunit
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T22C1.10 (rbg-2)
Membrane trafficking [BR:cel04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    CELE_T22C1.10 (rbg-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RAB3GAP2_N RAB3GAP2_C
Motif
Other DBs
NCBI-GeneID: 172574
NCBI-ProteinID: NP_001021631
WormBase: WBGene00004318
Ensembl: WBGene00004318
UniProt: Q22670
Position
I:join(7962065..7962164,7962216..7962473,7962521..7962765,7962958..7963557,7963677..7963823,7964342..7964994,7965448..7966018,7966686..7966896,7970527..7970591,7970689..7970976,7971453..7971845,7971899..7972291)
Genome map
AA seq 1307 aa AA seqDB search
MSVTPVILEAYCAVSDEVAKQVKKYLLGDFAEESKFERKNSESSDGSETQFCRATEKKEN
VEVWDDWGDKEEGAAENSLESDESIRNWLFRCDLKTYSDAEYLLVTWESRFVVLRKPPDE
PVYKIVCKQYIEGDPISNEITASSIFGLSNVRHIELLDSIIIALGTLDGHVYFFTEQGTM
LYFDRFSIFEPVNSLQFEVVKTGQTFIVVFTKGFFMINPISLKSVLYQAKVLIAKCEKTV
KQISESIELQSELLAPDIKGNIIHVIFTGLHKPSTLEQYISASYDSFYAKVEKPSLPLYS
TFMVTTEKEFAVFVWHDREEQDKLIDDVIKYGKSLVPSFGIRKFFGISTEPARIASHMRS
AVHAPTRSIIMETRVAQNVSRSPDCQYVAVTDRMARVLVIDIASRQVVLIFKGYRDASIS
WVSVTEDDRVAQFLTIFAPRRSLLEVWTVLGNVRVCAQHVPSSECNVVTGGENKMLCGRC
HVHTDSNSFFIDEKGEFHRIALPFHLALTSRSRQDQHDHLLLKQLENTKTGGEDWFQTFS
DLKMATSRKTTFQNALHNLSTAEEAHQFIARIRSIPTSASLGDLPNSAEKSIGFYARTVA
ETKPPVGEYDDKDTSNYKLDSIVERILECHMQKFGERTDMLNDSEVMKVGEWLKYVDLSQ
EDIDVFSEHWSEKQRHCLANLIFGPLFGSFEIDEYYDTVLEKIPVKRKNIVKLFYMRFEK
TTTHIDWRIFNRIVEMFLNLEKSETGILEQVDQMAMDSKDVPLGMILLSICWCARIQIRI
LKGNDEDEVENDHDLEEEDEKNKTIDEWDAISPEAEHLDCIIMCLHCVSLAQSLLKDDSN
ILRISDVVPRIDSYIRENVAKWIVSTPIDTDTIEKLFPRDPSENLAEKGNEEDRRKQMII
DFPDDKEVVIQRMYQIIPRVFEHDLVVADVCWEMMSQWFREKDDNFSYIKDCTTLLPQSI
VDPRLRHGIARLIWDKFIFMVFQSIVNMVEKTGRRPKDKETRKEIGFGEVKLEEFLMECE
KFLEVLMDSVRDMPPPIDFKQDLLVEMASSSFAAHLHQSKTAYRQDQFAILASRQPLVNF
HLVLHHQHLALALRLQLTTGLRFHPLRNLFCVTGNRAFFASLDSHPLIPLDRVDDATMEK
RHAFLVKVAEQGSMEERRLARHLEMEWKLTVNEISFMQALSSFRLGNDHQGSLELASCVR
DDRSAVALARVLAARLIQLANEANKRYSTAHSQYLCALAGEEAARVELYENSPDDPLVDS
NPKTWKDAVTSLGRAGNSVPQSAQAAIPFVRMNDIAKLYFGAQWVNN
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgactccggtcattttggaggcatactgtgcagttagtgatgaggttgccaag
caggttaaaaagtatttgctcggagatttcgcagaagagtcaaagttcgaacgaaaaaac
tctgagagctctgatggcagcgagacgcaattctgccgagcaacagaaaagaaggaaaat
gtggaagtgtgggacgattggggtgataaagaagagggcgccgcagagaattcattagaa
tctgacgaatctatacgaaattggcttttccgatgtgatttaaaaacatattctgatgca
gagtatcttcttgtcacttgggaatcaagattcgttgtgctacggaagcccccagatgag
ccggtctacaaaatagtttgcaaacaatatatagaaggagatccgataagcaatgaaatc
acagcttcatctatatttggactttctaatgttcgacacattgaacttctcgattcaatt
attattgctctggggactcttgacggtcatgtttatttctttaccgaacaaggaacaatg
ctctatttcgatcgattttcaatatttgaaccagttaatagcttgcaatttgaagttgta
aaaactggtcaaacattcattgtggttttcaccaaaggattcttcatgattaatccaatt
tcactcaaatcagttctttatcaagcgaaggttttgatagcaaaatgcgaaaaaacagtg
aaacaaatatcagaatcaattgaacttcaatcagaacttcttgctccggatattaaagga
aatataattcacgtgatattcacaggtcttcataaaccatcaactttggaacaatacatc
tcagcatcgtatgattcattttatgcaaaagttgaaaaaccatcacttccactttactca
acattcatggttacaacagaaaaagaatttgcagtctttgtatggcacgatcgagaagag
caagataagcttatagatgacgtcattaaatatggaaaatctctggtcccttcgtttgga
attcgaaaattttttggtatttctacggaacctgctcgaatcgcatcacatatgagatct
gctgtacatgcaccgactagaagtataattatggagacaagagtggcacaaaatgtgtcg
agatctcctgattgtcaatatgttgcagtaactgatcgtatggccagagttcttgtaatt
gatatagcatcccgtcaagtagttttgatcttcaaaggatatcgagatgcatcaatatca
tgggtatcagttactgaagatgatcgtgttgcacagtttttgactatatttgcaccgaga
aggtcgcttctggaagtttggactgtattgggaaatgttcgggtatgtgctcagcacgtt
ccatcttctgaatgtaatgtggtcactggtggagagaataaaatgttgtgtggccgatgt
cacgttcataccgattcaaactcattttttattgatgaaaaaggagaatttcatcgaatt
gctctaccattccatttggcactcacaagtagatcacgtcaagatcaacatgatcattta
cttttgaaacaacttgagaatacgaaaactggcggagaagattggtttcaaacattttct
gatcttaaaatggcgacatccaggaaaacaacattccaaaatgctcttcacaacttatca
actgctgaagaagctcatcaattcatcgcaagaattcgaagtattccaacatcagcttct
ttaggagatcttccaaattctgctgaaaaatcaattggattctatgcaagaactgtagca
gaaacaaagccaccagttggagagtacgatgataaggatacttcaaattataaattggat
tcgatagtcgagagaattcttgaatgtcatatgcagaagtttggtgaaagaaccgatatg
ttaaatgatagtgaagtgatgaaagttggagaatggctgaaatatgtggatttgtctcaa
gaggatattgatgttttttcagagcattggtcagaaaaacaacgacactgcttagccaac
ctgatatttggaccactttttggatcattcgagatagacgaatactatgatactgtactg
gagaaaattccagtaaaacggaaaaatatcgttaaattattctatatgagatttgaaaag
acaactacacacatcgattggagaatattcaatagaatagtggaaatgtttctgaatttg
gagaaatctgaaactggaatactggaacaagttgatcaaatggcaatggattcgaaagat
gtacctcttggaatgatattattatctatttgttggtgtgcaaggatacaaatcagaatt
ttgaaaggaaacgacgaggatgaagttgaaaatgatcatgatctggaagaggaagatgaa
aagaataaaacaattgatgaatgggatgctatatcaccagaagctgaacatctcgattgt
attataatgtgtttacattgtgtttcacttgctcaatccctcttaaaagacgattcgaat
attttgagaatttctgatgttgtgccaagaattgactcttatataagagaaaatgtcgca
aaatggatcgtatccactccaatcgacacagatacaattgaaaaactatttccacgtgat
ccaagtgaaaatctagctgaaaaaggaaatgaggaagatcgtcgaaaacaaatgataatt
gattttccggatgacaaagaagtggttatacagagaatgtatcaaattattccacgtgtt
tttgagcacgatcttgttgttgctgatgtgtgctgggagatgatgtcacaatggttccgc
gaaaaagatgacaatttttcttatatcaaggattgcacgacgcttctaccgcaatcaatt
gttgatccaagacttcgtcatggaatagctcgacttatatgggataaattcattttcatg
gttttccaatcaattgtaaatatggttgaaaagacgggtcgacgaccgaaagacaaggaa
acacgaaaagaaatcggttttggagaagtaaaactagaagaatttctaatggaatgtgaa
aagtttttggaagttctcatggattctgttcgagacatgccaccaccgattgattttaaa
caagatttgcttgtcgagatggcgagctcttctttcgctgctcacctgcatcaatccaaa
actgcttatcgtcaagatcaattcgcaatccttgcttcacgccaacctcttgtcaatttt
cacctggtgctccatcatcaacacctggctcttgctcttcgactacaactaacaactgga
cttcgtttccatcctttacgcaatttattctgtgtaactggtaatcgagcattctttgct
tcactcgattcacatccactcattccattggatcgagtcgatgatgctacaatggagaaa
cgacacgcttttttggttaaagttgcagaacaaggaagtatggaagaacgacgattggct
agacatttagaaatggaatggaaactgacagtcaatgaaatttcgttcatgcaagcatta
tcgtccttccgtcttggcaatgatcatcaaggatccttggaacttgcatcttgtgttcgg
gacgatcgatcagcagttgcactggcacgtgttcttgctgctagacttattcaacttgca
aatgaagcgaacaaacgatacagtactgctcattctcaatacctatgtgcacttgctggg
gaagaagctgctcgtgtagagctttatgaaaactctccagatgatcctttagtcgacagt
aatccaaaaacctggaaagatgcagttacatcacttggaagagctggaaactcggtacca
caatcggcgcaggccgccattccatttgttcgaatgaatgatattgccaaactatatttc
ggagctcagtgggtgaataattga

DBGET integrated database retrieval system