KEGG   Caenorhabditis elegans (nematode): CELE_T22H2.6
Entry
CELE_T22H2.6      CDS       T00019                                 

Gene name
pgrn-1
Definition
(RefSeq) ProGRaNulin homolog
  KO
K23879  progranulin
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T22H2.6 (pgrn-1)
Membrane trafficking [BR:cel04131]
 Endosome - Lysosome transport
  Others
   Others
    CELE_T22H2.6 (pgrn-1)
SSDB
Motif
Pfam: Granulin
Other DBs
NCBI-GeneID: 173054
NCBI-ProteinID: NP_492981
WormBase: WBGene00011936
Ensembl: WBGene00011936
UniProt: Q9U362
Position
I:join(11701631..11701909,11702157..11702573,11703023..11703268,11703459..11703593)
AA seq 358 aa
MLPSQINQNSKHITKKNDVRIFFCILYFNIKYFSFHTFIAELDQTIIIIDRQVVSDKIGV
LSVCPLHSSFSFIFSIKIMRLILLFLAVFLCRVTAHQCDAETECSDDETCCKLGDNTWGC
CPMPNAVCCDDRSHCCPTGTTCDPQGARCIGADEKHVPMKKKKPARKTVERNQFNEVVCP
DKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQNFAMIPHLR
KFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIACGVGKTCPAKTTCCNVRG
KNGEPKTMCCPLSNAICCENTCCPAGYHCVDGGKCEKHAKTMRTRFWNVKDDEDEDQI
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgttgccaagccaaattaaccaaaactcaaagcatatcacaaaaaaaaacgatgtcaga
atttttttctgtattttgtatttcaacattaaatacttttcgttccacacatttattgct
gagttagaccagaccattattattatcgatcgtcaagtcgttagtgataagattggcgtg
ttatcagtgtgcccccttcattcttcattctcgttcatcttttccatcaaaatcatgcgg
ctaattttactatttctagcagtgtttctttgtcgtgtgactgctcaccaatgcgacgca
gaaactgagtgctcggacgatgaaacttgctgtaagctcggagacaacacgtggggatgc
tgcccgatgccgaatgccgtgtgctgtgacgataggtcccattgctgtccaacagggacc
acttgtgatccacaaggagctagatgcattggagctgacgagaagcatgttccaatgaaa
aagaagaagcccgccagaaaaactgtggagaggaatcagttcaatgaagtcgtctgcccg
gacaaggctagcaagtgcccagatggttcgacgtgctgtctgttggagcagggaagctac
ggatgttgcccggtgccgaatgcggtgtgctgcgcagatatgttgcactgctgtccgaat
ggatttacgtgtcacgggcagttttgctcgcagaatttcgccatgatcccacacctgcgg
aagttcgcctccacctccatccatcgcaagccagcagtggagttcctttccgaagaagag
gaggatgatgatgatgaggaatccacgtcatcagaggatccagaaagcgatgtggacccg
attgcctgtggagttggaaagacgtgtccagcaaaaaccacgtgctgtaatgtccgagga
aagaatggggagccgaagacgatgtgttgtccattgagcaacgccatctgctgtgagaac
acttgctgcccagccggctatcactgtgttgatggtggaaagtgcgagaagcacgctaaa
actatgagaacccgattctggaatgtgaaggatgatgaggatgaggatcagatttaa

DBGET integrated database retrieval system