KEGG   Caenorhabditis elegans (nematode): CELE_T23F11.1Help
Entry
CELE_T23F11.1     CDS       T00019                                 

Gene name
ppm-2
Definition
(RefSeq) Probable protein phosphatase 2C T23F11.1
  KO
K14803  protein phosphatase PTC2/3 [EC:3.1.3.16]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cel01009]
    CELE_T23F11.1 (ppm-2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cel03009]
    CELE_T23F11.1 (ppm-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CELE_T23F11.1 (ppm-2)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    CELE_T23F11.1 (ppm-2)
Ribosome biogenesis [BR:cel03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    CELE_T23F11.1 (ppm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C PP2C_2
Motif
Other DBs
NCBI-GeneID: 175610
NCBI-ProteinID: NP_497949
WormBase: WBGene00011953
Ensembl: WBGene00011953
UniProt: P49596
Position
III:join(4650498..4650600,4650923..4651213,4651765..4651989,4652038..4652183,4652234..4652308,4652687..4652770,4652984..4653053,4653108..4653184)
Genome map
AA seq 356 aa AA seqDB search
MGQTLSEPVTKKESASCANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPKCAFFAVYDG
HGGSKVSQYSGINLHKKVVAQKEFSEGNMKEAIEKGFLELDQQMRVDEETKDDVSGTTAV
VVLIKEGDVYCGNAGDSRAVSSVVGEARPLSFDHKPSHETEARRIIAAGGWVEFNRVNGN
LALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTPDHEFIVLACDGIWDVMTNQEVV
DFVREKLAEKRDPQSICEELLTRCLAPDCQMGGLGCDNMTVVLVGLLHGQSPDTLFTKCA
RPAVFTGVNNEDGDQNQIQQDISRVINNFDGEQRVNAANQEEEEDDNEPAPANFQV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaacactcagtgagccagttactaaaaaagagtcggcgtcatgcgccaatgag
aattatttggtcggtagcagttgtatgcagggatggagagttgacatggaagatgcccat
acacatctcctttctcttcctgatgatccaaaatgtgcattctttgctgtctacgatgga
cacggtggatcgaaagtttcacaatattccggaattaatcttcacaaaaaagtcgtcgca
cagaaggaattttccgagggaaatatgaaagaagcaatcgaaaaaggattcctagaattg
gatcaacagatgagagttgatgaagagacaaaggatgatgttagtggaacgacagcagtt
gttgtattgataaaggagggagatgtttattgtggaaacgccggtgactctcgtgcagta
tcctcagttgttggagaagctcgtccactttcattcgatcacaagccatctcatgaaacc
gaagctcgacgtatcattgccgccggtggatgggttgagttcaatcgtgtcaatggtaat
ttggcactttcccgtgctctcggagattttgcattcaaaaattgtgacacaaagcctgct
gaggagcaaattgtcactgcattcccggatgtgatcactgacaagctgacaccggatcac
gagtttattgttcttgcatgtgatggtatttgggatgtaatgacaaatcaggaagtcgta
gattttgttcgtgagaagcttgctgagaagagggatccacaatcgatttgcgaagagctt
ctcactcggtgcttggctccagattgtcagatgggtggtctcggatgcgataatatgact
gttgttctcgtgggacttcttcatggacaatccccagatacacttttcacgaaatgtgcc
cgcccagcggtatttacgggtgttaataacgaggatggagatcaaaatcaaattcagcaa
gatatttcgcgtgtgataaacaactttgatggagaacaacgggtaaacgctgcgaatcaa
gaagaagaggaggatgacaatgaaccagcgccagccaacttccaagtttag

DBGET integrated database retrieval system