KEGG   Caenorhabditis elegans (nematode): CELE_T23G5.3Help
Entry
CELE_T23G5.3      CDS       T00019                                 

Gene name
T23G5.3
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTB_2 PBD
Motif
Other DBs
NCBI-GeneID: 188816
NCBI-ProteinID: NP_499040
WormBase: WBGene00011963
Ensembl: WBGene00011963
UniProt: Q03607
Position
III:complement(join(9229235..9229342,9229416..9229530,9229584..9229886,9229936..9230063,9231076..9231210))
Genome map
AA seq 262 aa AA seqDB search
MPPPPLISLDVEGVYFKTRIATLKSIEGTYFTKLFETNWREQLDRDGRLFIDRDSSVFPV
ILNFLRDHEKCSLPKDEYQLMRILREAVFFKIGPLRNMIEHKLRTFCTCPPELPSTPIPN
QILTQKENVPIVPRNLLLSKPPPPPPPPLPSLMQPKDTVQIPMRKPPTGRNSKKIKTSAD
SISLPRNFTHIAHVGWNGASVLFDKKMTDDPTVRKICDAAAEAVDLSAVYNVVNKNADEE
SHSVEVLITGGLMQSRDGTSRH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgccacctccaccattaatatcgcttgatgttgaaggtgtatattttaagacaaggata
gctactttgaaatctatagaaggaacttattttactaaattattcgaaactaattggagg
gagcagcttgatagagatggtagactcttcatcgaccgtgattcttcagtatttccggtt
attctcaactttctaagagatcatgagaaatgttcattgccaaaagacgaatatcagctt
atgcgaatcttacgtgaagcggtatttttcaaaattggaccacttcgaaacatgatagaa
cataagctgcgaacattttgtacttgcccacctgaacttccatcaactccaataccgaac
caaatcttgacccaaaaagaaaatgttccgattgtcccacgtaatcttcttctttcgaaa
ccacctccacctccaccaccaccacttccgtcattgatgcagccgaaggatactgtacaa
attccgatgagaaaacctccaactggcagaaattccaaaaaaattaaaacgtctgcagat
tcgattagtcttccaaggaactttacacatattgcacatgttggttggaatggtgcatcg
gtactttttgataagaaaatgactgatgatccgactgtgaggaaaatctgtgatgctgct
gcagaggcagttgatcttagtgcggtatacaatgttgtcaacaaaaatgcggatgaggag
agccatagcgtggaagtgctcataactggaggattaatgcagtcaagagatggaacatct
cgtcactaa

DBGET integrated database retrieval system