KEGG   Caenorhabditis elegans (nematode): CELE_T28F2.3
Entry
CELE_T28F2.3      CDS       T00019                                 

Gene name
cah-6
Definition
(RefSeq) Alpha-carbonic anhydrase domain-containing protein
  KO
K01674  carbonic anhydrase [EC:4.2.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00910  Nitrogen metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CELE_T28F2.3 (cah-6)
Enzymes [BR:cel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     CELE_T28F2.3 (cah-6)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 189049
NCBI-ProteinID: NP_491189
WormBase: WBGene00000284
Ensembl: WBGene00000284
UniProt: O02637
Position
I:join(3629471..3629739,3629901..3630198,3630246..3630476,3630522..3630608,3630656..3630730)
AA seq 319 aa
MAFLSQLQGGFAQLKQKAEAAAPSIADSLNQLKEAPKFMESAFKTGLNKVKLDSLGKVLN
VPSLGRTQSPIDIVPVITAFGEHLQNAHFEVTYESTGEFKAVNDGNSIWLMREGNSSELA
ISFLPEEQYHLDAVNFHWATEPMNGSEHTIGGVGYAGEMHLIHRNTRFATMADALKQPNG
VIAIAVFLNESHDDNAVFSPLINLLPQVIYKGSECKLCSFDFQTFFPVAEKTKEFWMYEG
SETTDPFRETVNWIVIRAALPISSHQLDKLREVRAGRYDEEFSDKVPMKPLRPIQNPSSR
TIQSSFRSVAGAPDLGFRQ
NT seq 960 nt   +upstreamnt  +downstreamnt
atggcattccttagtcaactacagggtgggtttgcccaactcaagcaaaaagccgaagcg
gcggctccatcaatcgctgactcgttgaatcaattgaaagaggctccaaagttcatggag
agtgcctttaaaactggattgaacaaggtgaagctggattcattgggcaaggtgctcaat
gtgccatcgttgggaaggactcagtcgccgattgatatcgttccggttatcactgcgttt
ggcgagcatcttcagaatgcacactttgaagtaacctacgaatcgaccggtgaattcaaa
gcagtaaacgatggcaattcgatttggctgatgcgtgagggtaacagcagtgagctggct
atttcattcctcccagaagagcaatatcatctggacgctgtaaattttcattgggcaact
gagccgatgaacggatccgagcacacaattggtggggttgggtacgcaggagaaatgcat
cttattcatcggaatacgcgattcgccacaatggccgatgctctcaaacaacccaatggg
gttattgcgatcgctgtttttctgaatgaatcccacgacgacaacgcagtgttcagtccg
ttgatcaatcttctaccacaagtgatctacaaaggaagtgaatgcaaactctgctcattc
gacttccaaacattcttcccggttgccgagaagacgaaggaattttggatgtacgaagga
tcggagacaactgatccattccgagagactgtcaactggattgtcatccgagcggctctt
ccgattagttctcatcagctcgacaagctccgcgaggtccgtgccggacgctacgacgaa
gaattctctgataaggtcccaatgaagccacttcgtccaattcagaacccctcctctcgt
acaatccaaagtagctttcgctcagtcgccggtgctcccgacctcggattccgacagtga

DBGET integrated database retrieval system