KEGG   Caenorhabditis elegans (nematode): CELE_W01B6.1
Entry
CELE_W01B6.1      CDS       T00019                                 

Gene name
cwn-2
Definition
(RefSeq) Protein Wnt-2
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 177870
NCBI-ProteinID: NP_501822
WormBase: WBGene00000858
Ensembl: WBGene00000858
UniProt: P34889
Position
IV:join(10067875..10067954,10068209..10068362,10068411..10068796,10068841..10068976,10069023..10069183,10069801..10069966)
AA seq 360 aa
MIPRRSCWLILLLNLLNVQSLLDASWWSTVAQLSTALAGHNVKPVCELPGLSPGQAQVCE
LFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMATREAAFTYAILSA
GVTHEIGRRCKQGLLTSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEH
DPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKI
LRNKYDKAIRVQINDRGNLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGT
EGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDICK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgattccacggagaagttgttggctcatacttcttcttaatttattaaatgttcaatca
ttattagatgcttcttggtggtcaacagttgcacaattgtcaactgctttagcagggcat
aacgtgaagcctgtatgcgaattacccggactttcgcctggtcaagctcaagtatgtgag
cttttcaaagatcatatgccagctgtgagcatcggagcacaaaatgctattcaggaatgt
caacgacaattcacaggtcatcgatggaattgttcaacacactacagtacaggaatgctt
ggaccaattcataaaatggcaacacgagaagctgcattcacatacgcaattctatcagct
ggagttacacatgaaattggaagacggtgcaaacagggacttttaacttcatgtggatgc
tctgatgagactaaaccaaaaaatgttccaacagattggagttggggtggatgtggagat
aatgttgaatatggttacaagttttcgagagattttattgatattcgagagaaagaacac
gatccaaagagaaatcacgataacggtagaagtttaatgaatcgaagaaataacgaagct
ggaagaaaaattttgaaacgtcatcgaaaaccaaaatgcaaatgccatggagtttcgggt
gcgtgcaacatgaaaacctgttggatgcaacttccttcgatggaacaagtcggaaaaatc
ttgaggaataaatatgacaaagcaatcagagttcagatcaatgatagaggaaatttgcaa
cttctagcagatgaagctacaaaagaaagaaaaacaagagcattgccaacggatttagta
tttatggatgattcacctgattactgtagatttgatcgacattctggaacgttaggaact
gaaggaagggtttgcaaacgtggctcgggtggagctgaaggctgtgatagcttgtgctgt
ggacgaggatataatacctacactcaagaagtaaaatcaaaatgtaattgcaaatttgaa
tggtgttgcaaagtggtatgtcaaacttgcaataatgtgacacaagtggatatttgtaaa
taa

DBGET integrated database retrieval system