KEGG   Caenorhabditis elegans (nematode): CELE_W01F3.2Help
Entry
CELE_W01F3.2      CDS       T00019                                 

Gene name
W01F3.2
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pilin_N
Motif
Other DBs
NCBI-GeneID: 180351
NCBI-ProteinID: NP_507992
WormBase: WBGene00012185
Ensembl: WBGene00012185
UniProt: O62390
Position
V:join(20660398..20660484,20660525..20660760,20660950..20661322,20661665..20661742,20661789..20661938)
Genome map
AA seq 307 aa AA seqDB search
MRLSILLLVAAHVANGLFGFGEKKTTQAPKISLGSEISIPHTDEDQDTGEIVIPFNDPST
TTTRRRTATTTGIPVISVGGIGLDRTRSTVDVRSFTTTINPRFTAATKRLPSSDRHSSSG
CPNRIDAYTFGPDSDYAFYEQQVFKISNNRISDRTTLVEEFKDGPNQVNGALYDPEREIL
WLVDGRSVYGYKKDGSDNWKLQSVFPKELPSSIGFTPEAAVRWHNKHQLLLSNGGKFALY
DEYWNKSLMTGRTESYFENLPDRVRGISTWNSQGHAHIYTQSLVFEYDSEMKKVTGDGVP
LGDFWRC
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagattatcgattttactgctagtcgctgcacacgtggcaaatgggcttttcgggttt
ggcgagaagaaaactacgcaagcaccgaaaatatctctcgggtccgagataagcattcca
cacaccgacgaggatcaggacaccggagaaattgtgattccgttcaatgatcctagcact
acaacaacgagaagaagaactgcaactactacaggaattccagtgatttctgtgggtgga
atcggtttagacagaactcgtagtacggtggatgttagatctttcaccacgacaattaac
ccaagattcacagcggccaccaagcgacttccatcgtcggatcgtcactcatcttcggga
tgtcctaatcgtattgatgcgtacacatttggcccagacagtgattatgcattttatgaa
caacaagtgttcaaaatttcgaacaacagaatttctgatcggaccactttagtcgaggaa
ttcaaagatggtccaaaccaagtgaatggggccctatacgacccggagcgggagattttg
tggttggtggatggaagaagcgtttatgggtataaaaaagatggatctgacaattggaag
ctgcagtcagtttttccaaaggaactaccgtcgtctatcggttttacaccggaagctgca
gttagatggcataataaacatcagttattgctctcgaacggtggtaaattcgcattatat
gatgaatactggaacaaatctttgatgaccggaaggactgaaagctattttgagaatctt
cccgaccgtgtccggggtatttccacgtggaattcgcaaggacatgcgcacatttacacg
caatctctagtttttgaatacgattcggaaatgaagaaagtgacaggcgatggagtacca
cttggcgatttttggagatgctag

DBGET integrated database retrieval system